KEGG   Homo sapiens (human): 47Help
Entry
47                CDS       T01001                                 

Gene name
ACLY, ACL, ATPCL, CLATP
Definition
(RefSeq) ATP citrate lyase (EC:2.3.3.8)
  KO
K01648  
ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Drug target
Bempedoic acid: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    47 (ACLY)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     47 (ACLY)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   47 (ACLY)
  Exosomal proteins of bladder cancer cells
   47 (ACLY)
  Exosomal proteins of melanoma cells
   47 (ACLY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 1101 aa AA seqDB search
MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPD
QLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVP
SPRSLQGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQK
FYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG
IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYV
SRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIG
GTEEYKICRGIKEGRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALK
EAGVFVPRSFDELGEIIQSVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASF
MTSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH
GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFV
NKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPN
LILNVDGLIGVAFVDMLRNCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLK
QGLYRHPWDDISYVLPEHMSM
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaaggcaatttcagagcagacgggcaaagaactcctttacaagttcatctgt
accacctcagccatccagaatcggttcaagtatgctcgggtcactcctgacacagactgg
gcccgcttgctgcaggaccacccctggctgctcagccagaacttggtagtcaagccagac
cagctgatcaaacgtcgtggaaaacttggtctcgttggggtcaacctcactctggatggg
gtcaagtcctggctgaagccacggctgggacaggaagccacagttggcaaggccacaggc
ttcctcaagaactttctgatcgagcccttcgtcccccacagtcaggctgaggagttctat
gtctgcatctatgccacccgagaaggggactacgtcctgttccaccacgaggggggtgtg
gacgtgggtgatgtggacgccaaggcccagaagctgcttgttggcgtggatgagaaactg
aatcctgaggacatcaaaaaacacctgttggtccacgcccctgaagacaagaaagaaatt
ctggccagttttatctccggcctcttcaatttctacgaggacttgtacttcacctacctc
gagatcaatccccttgtagtgaccaaagatggagtctatgtccttgacttggcggccaag
gtggacgccactgccgactacatctgcaaagtgaagtggggtgacatcgagttccctccc
cccttcgggcgggaggcatatccagaggaagcctacattgcagacctcgatgccaaaagt
ggggcaagcctgaagctgaccttgctgaaccccaaagggaggatctggaccatggtggcc
gggggtggcgcctctgtcgtgtacagcgataccatctgtgatctagggggtgtcaacgag
ctggcaaactatggggagtactcaggcgcccccagcgagcagcagacctatgactatgcc
aagactatcctctccctcatgacccgagagaagcacccagatggcaagatcctcatcatt
ggaggcagcatcgcaaacttcaccaacgtggctgccacgttcaagggcatcgtgagagca
attcgagattaccagggccccctgaaggagcacgaagtcacaatctttgtccgaagaggt
ggccccaactatcaggagggcttacgggtgatgggagaagtcgggaagaccactgggatc
cccatccatgtctttggcacagagactcacatgacggccattgtgggcatggccctgggc
caccggcccatccccaaccagccacccacagcggcccacactgcaaacttcctcctcaac
gccagcgggagcacatcgacgccagcccccagcaggacagcatctttttctgagtccagg
gccgatgaggtggcgcctgcaaagaaggccaagcctgccatgccacaagattcagtccca
agtccaagatccctgcaaggaaagagcaccaccctcttcagccgccacaccaaggccatt
gtgtggggcatgcagacccgggccgtgcaaggcatgctggactttgactatgtctgctcc
cgagacgagccctcagtggctgccatggtctaccctttcactggggaccacaagcagaag
ttttactgggggcacaaagagatcctgatccctgtcttcaagaacatggctgatgccatg
aggaagcatccggaggtagatgtgctcatcaactttgcctctctccgctctgcctatgac
agcaccatggagaccatgaactatgcccagatccggaccatcgccatcatagctgaaggc
atccctgaggccctcacgagaaagctgatcaagaaggcggaccagaagggagtgaccatc
atcggacctgccactgttggaggcatcaagcctgggtgctttaagattggcaacacaggt
gggatgctggacaacatcctggcctccaaactgtaccgcccaggcagcgtggcctatgtc
tcacgttccggaggcatgtccaacgagctcaacaatatcatctctcggaccacggatggc
gtctatgagggcgtggccattggtggggacaggtacccgggctccacattcatggatcat
gtgttacgctatcaggacactccaggagtcaaaatgattgtggttcttggagagattggg
ggcactgaggaatataagatttgccggggcatcaaggagggccgcctcactaagcccatc
gtctgctggtgcatcgggacgtgtgccaccatgttctcctctgaggtccagtttggccat
gctggagcttgtgccaaccaggcttctgaaactgcagtagccaagaaccaggctttgaag
gaagcaggagtgtttgtgccccggagctttgatgagcttggagagatcatccagtctgta
tacgaagatctcgtggccaatggagtcattgtacctgcccaggaggtgccgcccccaacc
gtgcccatggactactcctgggccagggagcttggtttgatccgcaaacctgcctcgttc
atgaccagcatctgcgatgagcgaggacaggagctcatctacgcgggcatgcccatcact
gaggtcttcaaggaagagatgggcattggcggggtcctcggcctcctctggttccagaaa
aggttgcctaagtactcttgccagttcattgagatgtgtctgatggtgacagctgatcac
gggccagccgtctctggagcccacaacaccatcatttgtgcgcgagctgggaaagacctg
gtctccagcctcacctcggggctgctcaccatcggggatcggtttgggggtgccttggat
gcagcagccaagatgttcagtaaagcctttgacagtggcattatccccatggagtttgtg
aacaagatgaagaaggaagggaagctgatcatgggcattggtcaccgagtgaagtcgata
aacaacccagacatgcgagtgcagatcctcaaagattacgtcaggcagcacttccctgcc
actcctctgctcgattatgcactggaagtagagaagattaccacctcgaagaagccaaat
cttatcctgaatgtagatggtctcatcggagtcgcatttgtagacatgcttagaaactgt
gggtcctttactcgggaggaagctgatgaatatattgacattggagccctcaatggcatc
tttgtgctgggaaggagtatggggttcattggacactatcttgatcagaagaggctgaag
caggggctgtatcgtcatccgtgggatgatatttcatatgttcttccggaacacatgagc
atgtaa

DBGET integrated database retrieval system