KEGG   Homo sapiens (human): 4707Help
Entry
4707              CDS       T01001                                 

Gene name
NDUFB1, CI-MNLL, CI-SGDH, MNLL
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B1
  KO
K03957  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4707 (NDUFB1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4707 (NDUFB1)
  Environmental adaptation
   04714 Thermogenesis
    4707 (NDUFB1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4707 (NDUFB1)
   05012 Parkinson's disease
    4707 (NDUFB1)
   05016 Huntington's disease
    4707 (NDUFB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4707 (NDUFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_oxidored
Motif
Other DBs
NCBI-GeneID: 4707
NCBI-ProteinID: NP_004536
OMIM: 603837
HGNC: 7695
Ensembl: ENSG00000183648
Vega: OTTHUMG00000171180
Pharos: O75438(Tclin)
UniProt: O75438
Structure
PDB: 

Jmol
Position
14q32.12
AA seq 105 aa AA seqDB search
MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWV
HVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgatttgctggcgtcacccctctgctccgtgcgggcgcggcgaatggcaggtcccgagg
tcgcagcttccactggcgcgggttgagttccctgttgcccttggtctcggggtcgctgta
ggcgctgaggctgcagctatcatggtgaacttacttcagattgtgcgggaccactgggtt
catgttcttgtccctatgggatttgtcattggatgttatttagacagaaagagtgatgaa
cggctaactgccttccggaacaagagtatgttatttaaaagggaattgcaacccagtgaa
gaagttacctggaagtaa

DBGET integrated database retrieval system