KEGG   Homo sapiens (human): 4712Help
Entry
4712              CDS       T01001                                 

Gene name
NDUFB6, B17, CI
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa (EC:1.6.5.3 1.6.99.3)
Orthology
K03962  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4712 (NDUFB6)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4712 (NDUFB6)
   05012 Parkinson's disease
    4712 (NDUFB6)
   05016 Huntington's disease
    4712 (NDUFB6)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4712 (NDUFB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p21.1
AA seq 97 aa AA seqDB search
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM
EKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgacggggtacactccggatgagaaactgcggctgcagcagctgcgagagctgagaagg
cgatggctgaaggaccaggagctgagccctcgggagccggtgctgcccccacagaagatg
gggcctatggagaaattctggaataaatttttggagaataaatccccttggaggaaaatg
gaaaaaccatatggcatagttgaaaagaagtccagaatattccctggtgatacaattctg
gagactggagaagtaattccaccaatgaaagaatttcctgatcaacatcattaa

DBGET integrated database retrieval system