KEGG   Homo sapiens (human): 4713Help
Entry
4713              CDS       T01001                                 

Gene name
NDUFB7, B18, CI-B18
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (EC:1.6.5.3 1.6.99.3)
Orthology
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4713 (NDUFB7)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4713 (NDUFB7)
   05012 Parkinson's disease
    4713 (NDUFB7)
   05016 Huntington's disease
    4713 (NDUFB7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4713 (NDUFB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 137 aa AA seqDB search
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccacctggtccggcgctacctgggcgatgcctcggtggagcccgaccccctg
cagatgccaaccttcccgccagactacggcttccccgaacgcaaggagcgcgagatggtg
gccacacagcaggagatgatggacgcgcagctgaggctccagctgcgggactactgcgcc
caccacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc
aagcaggagcggcacgactgggactactgcgagcaccgcgactatgtgatgcgcatgaag
gagtttgagcgggagcggaggctgctccagcggaagaagcggcgggagaagaaggcggca
gagttggccaaaggccagggacccggggaagtggaccccaaggtggccctgtag

DBGET integrated database retrieval system