KEGG   Homo sapiens (human): 4713Help
Entry
4713              CDS       T01001                                 

Gene name
NDUFB7, B18, CI-B18
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa (EC:1.6.5.3 1.6.99.3)
Orthology
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 137 aa AA seqDB search
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccacctggtccggcgctacctgggcgatgcctcggtggagcccgaccccctg
cagatgccaaccttcccgccagactacggcttccccgaacgcaaggagcgcgagatggtg
gccacacagcaggagatgatggacgcgcagctgaggctccagctgcgggactactgcgcc
caccacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc
aagcaggagcggcacgactgggactactgcgagcaccgcgactatgtgatgcgcatgaag
gagtttgagcgggagcggaggctgctccagcggaagaagcggcgggagaagaaggcggca
gagttggccaaaggccagggacccggggaagtggaccccaaggtggccctgtag

DBGET integrated database retrieval system