KEGG   Homo sapiens (human): 4716Help
Entry
4716              CDS       T01001                                 

Gene name
NDUFB10, PDSW
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
Orthology
K03966  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4716 (NDUFB10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4716 (NDUFB10)
   05012 Parkinson's disease
    4716 (NDUFB10)
   05016 Huntington's disease
    4716 (NDUFB10)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4716 (NDUFB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 172 aa AA seqDB search
MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI
KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccggacagctgggacaaggatgtgtaccctgagcccccgcgccgcacgccggtgcag
cccaatcccatcgtctacatgatgaaagcgttcgacctcatcgtggaccgacccgtgacc
ctcgtgagagaatttatagagcggcagcacgcaaagaacaggtattactactaccaccgg
cagtaccgccgcgtgccagacatcactgagtgcaaggaggaggacatcatgtgcatgtat
gaagccgaaatgcagtggaagagggactacaaagtcgaccaagaaattatcaacattatg
caggatcggctcaaagcctgtcagcagagggaaggacagaactaccagcagaactgtatc
aaggaagtggagcagttcacccaggtggccaaggcctaccaggaccgctatcaggacctg
ggggcctacagttctgccaggaagtgcctggccaaacagaggcagaggatgctgcaagag
agaaaagctgcaaaagaggccgccgctgccacctcctga

DBGET integrated database retrieval system