KEGG   Homo sapiens (human): 4717Help
Entry
4717              CDS       T01001                                 

Gene name
NDUFC1, KFYI
Definition
NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa
Orthology
K03967  
NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4717 (NDUFC1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4717 (NDUFC1)
   05012 Parkinson's disease
    4717 (NDUFC1)
   05016 Huntington's disease
    4717 (NDUFC1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4717 (NDUFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31.1
AA seq 76 aa AA seqDB search
MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIK
QHNEDILEYKRRNGLE
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtccgccttgctgcgtcccctttcccggctgctggcccccgccaggctcccg
agcggcccttcagtgcgatcaaagttctacgtgcgagagccgccgaatgccaaacctgac
tggctgaaagttgggttcaccttgggcaccactgtcttcttgtggatctatctcatcaaa
caacacaatgaagatattttagagtacaaaagaagaaatgggctggaataa

DBGET integrated database retrieval system