KEGG   Homo sapiens (human): 4725Help
Entry
4725              CDS       T01001                                 

Gene name
NDUFS5, CI-15k, CI15K
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Orthology
K03938  
NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4725 (NDUFS5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4725 (NDUFS5)
   05012 Parkinson's disease
    4725 (NDUFS5)
   05016 Huntington's disease
    4725 (NDUFS5)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4725 (NDUFS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.2-p33
AA seq 106 aa AA seqDB search
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcttggacatccagaaaaggttcggccttaacatagatcgatggttgacaatc
cagagtggtgaacagccctacaagatggctggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcacatggaatcggttatactcgggcagagaaagagtgcaagatagaatat
gatgatttcgtagagtgtttgcttcggcagaaaacgatgagacgtgcaggtaccatcagg
aagcagcgggataagctgataaaggaaggaaagtacacccctccacctcaccacattggc
aagggggagcctcggccctga

DBGET integrated database retrieval system