KEGG   Homo sapiens (human): 4728Help
Entry
4728              CDS       T01001                                 

Gene name
NDUFS8, CI-23k, CI23KD, TYKY
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase) (EC:1.6.5.3 1.6.99.3)
Orthology
K03941  
NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4728 (NDUFS8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4728 (NDUFS8)
   05012 Parkinson's disease
    4728 (NDUFS8)
   05016 Huntington's disease
    4728 (NDUFS8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4728 (NDUFS8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4728 (NDUFS8)
   1.6.99  With other, unknown, acceptors
    1.6.99.3  NADH dehydrogenase
     4728 (NDUFS8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 210 aa AA seqDB search
MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLL
WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI
CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE
LLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcctgaccacgcctatgctgctgcgggccctggcccaggctgcacgtgcagga
cctcctggtggccggagcctccacagcagtgcagtggcagccacctacaagtatgtgaac
atgcaggatcccgagatggacatgaagtcagtgactgaccgggcagcccgcaccctgctg
tggactgagctcttccgaggcctgggcatgaccctgagctacctgttccgggaaccggcc
accatcaactacccgttcgagaagggcccgctgagccctcgcttccgtggggagcatgcg
ctgcgccggtacccatccggggaggagcgttgcattgcctgcaagctctgcgaggccatc
tgccccgcccaggccatcaccatcgaggctgagccaagagctgatggcagccgccggacc
acccgctatgacatcgacatgaccaagtgcatctactgcggcttctgccaggaggcctgt
cccgtggatgccatcgtcgagggccccaactttgagttctccacggagacccatgaggag
ctgctgtacaacaaggagaagttgctcaacaacggggacaagtgggaggccgagatcgcc
gccaacatccaggctgactacttgtatcggtga

DBGET integrated database retrieval system