KEGG   Homo sapiens (human): 4731Help
Entry
4731              CDS       T01001                                 

Gene name
NDUFV3, CI-10k, CI-9KD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit V3
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4731 (NDUFV3)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4731 (NDUFV3)
  Environmental adaptation
   04714 Thermogenesis
    4731 (NDUFV3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4731 (NDUFV3)
   05012 Parkinson's disease
    4731 (NDUFV3)
   05016 Huntington's disease
    4731 (NDUFV3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4731 (NDUFV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFV3
Motif
Other DBs
NCBI-GeneID: 4731
NCBI-ProteinID: NP_001001503
OMIM: 602184
HGNC: 7719
Ensembl: ENSG00000160194
Vega: OTTHUMG00000086823
Pharos: P56181(Tclin)
UniProt: P56181
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 108 aa AA seqDB search
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP
VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccgtgtttgctgcggcaaggacgagccggggcgctgaagactatgctccag
gaagcccaggtgtttcgaggacttgcttctacggtttctttgtctgcggaatcagggaag
agtgaaaagggtcagccacagaattccaagaagcaaagtccaccaaaaaagccagcccca
gtgcctgctgagccgtttgacaacactacctacaagaacctgcagcatcatgactacagc
acgtacaccttcttagacctcaacctcgaactctcaaaattcaggatgcctcagccctcc
tcaggccgggagtcacctcgacactga

DBGET integrated database retrieval system