KEGG   Homo sapiens (human): 4731Help
Entry
4731              CDS       T01001                                 

Gene name
NDUFV3, CI-10k, CI-9KD
Definition
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa (EC:1.6.5.3)
Orthology
K03944  
NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4731 (NDUFV3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4731 (NDUFV3)
   05012 Parkinson's disease
    4731 (NDUFV3)
   05016 Huntington's disease
    4731 (NDUFV3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4731 (NDUFV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
21q22.3
AA seq 108 aa AA seqDB search
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP
VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccgtgtttgctgcggcaaggacgagccggggcgctgaagactatgctccag
gaagcccaggtgtttcgaggacttgcttctacggtttctttgtctgcggaatcagggaag
agtgaaaagggtcagccacagaattccaagaagcaaagtccaccaaaaaagccagcccca
gtgcctgctgagccgtttgacaacactacctacaagaacctgcagcatcatgactacagc
acgtacaccttcttagacctcaacctcgaactctcaaaattcaggatgcctcagccctcc
tcaggccgggagtcacctcgacactga

DBGET integrated database retrieval system