KEGG   Homo sapiens (human): 4731Help
Entry
4731              CDS       T01001                                 

Gene name
NDUFV3, CI-10k, CI-9KD
Definition
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa (EC:1.6.5.3)
Orthology
K03944  
NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
21q22.3
AA seq 108 aa AA seqDB search
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP
VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccgtgtttgctgcggcaaggacgagccggggcgctgaagactatgctccag
gaagcccaggtgtttcgaggacttgcttctacggtttctttgtctgcggaatcagggaag
agtgaaaagggtcagccacagaattccaagaagcaaagtccaccaaaaaagccagcccca
gtgcctgctgagccgtttgacaacactacctacaagaacctgcagcatcatgactacagc
acgtacaccttcttagacctcaacctcgaactctcaaaattcaggatgcctcagccctcc
tcaggccgggagtcacctcgacactga

DBGET integrated database retrieval system