KEGG   Homo sapiens (human): 4741Help
Entry
4741              CDS       T01001                                 

Gene name
NEFM, NEF3, NF-M, NFM
Definition
neurofilament, medium polypeptide
Orthology
K04573  
neurofilament medium polypeptide (neurofilament 3)
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    4741 (NEFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21
AA seq 540 aa AA seqDB search
MARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFAGSITGPLYTHRPPITISSKI
QKPKVEAPKLKVQHKFVEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKEAAEEKE
EEPEAEEEEVAAKKSPVKATAPEVKEEEGEKEEEEGQEEEEEEDEGAKSDQAEEGGSEKE
GSSEKEEGEQEEGETEAEAEGEEAEAKEEKKVEEKSEEVATKEELVADAKVEKPEKAKSP
VPKSPVEEKGKSPVPKSPVEEKGKSPVPKSPVEEKGKSPVPKSPVEEKGKSPVSKSPVEE
KAKSPVPKSPVEEAKSKAEVGKGEQKEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAES
PVKEEAVAEVVTITKSVKVHLEKETKEEGKPLQQEKEKEKAGGEGGSEEEGSDKGAKGSR
KEDIAVNGEVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPADEKKGGDKSEEKVVVTK
TVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQSD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcatttgcgcgaataccaggacctcctcaacgtcaagatggctctggatata
gaaatcgctgcgtacagaaaactcctggagggtgaagagactagatttagcacatttgca
ggaagcatcactgggccactgtatacacaccgacccccaatcacaatatccagtaagatt
cagaaacccaaggtggaagctcccaagcttaaggtccaacacaaatttgtcgaggagatc
atagaggaaaccaaagtggaggatgagaagtcagaaatggaagaggccctgacagccatt
acagaggaattggccgtttccatgaaggaagagaagaaagaagcagcagaagaaaaggaa
gaggaacccgaagctgaagaagaagaagtagctgccaaaaagtctccagtgaaagcaact
gcacctgaagttaaagaagaggaaggggaaaaggaggaagaagaaggccaggaagaagag
gaggaagaagatgagggagctaagtcagaccaagccgaagagggaggatccgagaaggaa
ggctctagtgaaaaagaggaaggtgagcaggaagaaggagaaacagaagctgaagctgaa
ggagaggaagccgaagctaaagaggaaaagaaagtggaggaaaagagtgaggaagtggct
accaaggaggagctggtggcagatgccaaggtggaaaagccagaaaaagccaagtctcct
gtgccaaaatcaccagtggaagagaaaggcaagtctcctgtgcccaagtcaccagtggaa
gagaaaggcaagtctcctgtgcccaagtcaccagtggaagagaaaggcaagtctcctgtg
ccgaaatcaccagtggaagagaaaggcaagtctcctgtgtcaaaatcaccagtggaagag
aaagccaaatctcctgtgccaaaatcaccagtggaagaggcaaagtcaaaagcagaagtg
gggaaaggtgaacagaaagaggaagaagaaaaggaagtcaaggaagctcccaaggaagag
aaggtagagaaaaaggaagagaaaccaaaggatgtgccagagaagaagaaagctgagtcc
cctgtaaaggaggaagctgtggcagaggtggtcaccatcaccaaatcggtaaaggtgcac
ttggagaaagagaccaaagaagaggggaagccactgcagcaggagaaagagaaggagaaa
gcgggaggagagggaggaagtgaggaggaagggagtgataaaggtgccaagggatccagg
aaggaagacatagctgtcaatggggaggtagaaggaaaagaggaggtagagcaggagacc
aaggaaaaaggcagtgggagggaagaggagaaaggcgttgtcaccaatggcctagacttg
agcccagcagatgaaaagaaggggggtgataaaagtgaggagaaagtggtggtgaccaaa
acggtagaaaaaatcaccagtgaggggggagatggtgctaccaaatacatcactaaatct
gtaaccgtcactcaaaaggttgaagagcatgaagagacctttgaggagaaactagtgtct
actaaaaaggtagaaaaagtcacttcacacgccatagtaaaggaagtcacccagagtgac
taa

DBGET integrated database retrieval system