KEGG   Homo sapiens (human): 4745Help
Entry
4745              CDS       T01001                                 

Gene name
NELL1, IDH3GL, NRP1
Definition
(RefSeq) neural EGFL like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.1
AA seq 810 aa AA seqDB search
MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCK
DGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLE
GEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDSYGVSRLSGSV
WTMAGSPCTTCKCKNGRVCCSVDFECLQNN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgccgatggatttgattttagttgtgtggttctgtgtgtgcactgccaggacagtggtg
ggctttgggatggaccctgaccttcagatggatatcgtcaccgagcttgaccttgtgaac
accacccttggagttgctcaggtgtctggaatgcacaatgccagcaaagcatttttattt
caagacatagaaagagagatccatgcagctcctcatgtgagtgagaaattaattcagctg
ttccggaacaagagtgaattcaccattttggccactgtacagcagaagccatccacttca
ggagtgatactgtccattcgagaactggagcacagctattttgaactggagagcagtggc
ctgagggatgagattcggtatcactacatacacaatgggaagccaaggacagaggcactt
ccttaccgcatggcagatggacaatggcacaaggttgcactgtcagttagcgcctctcat
ctcctgctccatgtcgactgtaacaggatttatgagcgtgtgatagaccctccagatacc
aaccttcccccaggaatcaatttatggcttggccagcgcaaccaaaagcatggcttattc
aaagggatcatccaagatgggaagatcatctttatgccgaatggatatataacacagtgt
ccaaatctaaatcacacttgcccaacctgcagtgatttcttaagcctggtgcaaggaata
atggatttacaagagcttttggccaagatgactgcaaaactaaattatgcagagacaaga
cttagtcaattggaaaactgtcattgtgagaagacttgtcaagtgagtggactgctctat
cgagatcaagactcttgggtagatggtgaccattgcaggaactgcacttgcaaaagtggt
gccgtggaatgccgaaggatgtcctgtccccctctcaattgctccccagactccctccca
gtgcacattgctggccagtgctgtaaggtctgccgaccaaaatgtatctatggaggaaaa
gttcttgcagaaggccagcggattttaaccaagagctgtcgggaatgccgaggtggagtt
ttagtaaaaattacagaaatgtgtcctcctttgaactgctcagaaaaggatcacattctt
cctgagaatcagtgctgccgtgtctgtagaggtcataacttttgtgcagaaggacctaaa
tgtggtgaaaactcagagtgcaaaaactggaatacaaaagctacttgtgagtgcaagagt
ggttacatctctgtccagggagactctgcctactgtgaagatattgatgagtgtgcagct
aagatgcattactgtcatgccaatactgtgtgtgtcaaccttcctgggttatatcgctgt
gactgtgtcccaggatacattcgtgtggatgacttctcttgtacagaacacgatgaatgt
ggcagcggccagcacaactgtgatgagaatgccatctgcaccaacactgtccagggacac
agctgcacctgcaaaccgggctacgtggggaacgggaccatctgcagagctttctgtgaa
gagggctgcagatacggtggaacgtgtgtggctcccaacaaatgtgtctgtccatctgga
ttcacaggaagccactgcgagaaagatattgatgaatgttcagagggaatcattgagtgc
cacaaccattcccgctgcgttaacctgccagggtggtaccactgtgagtgcagaagcggt
ttccatgacgatgggacctattcactgtccggggagtcctgtattgacattgatgaatgt
gccttaagaactcacacctgttggaacgattctgcctgcatcaacctggcagggggcttt
gactgtctctgcccctctgggccctcctgctctggtgactgtcctcatgaaggggggctg
aagcacaatggccaggtgtggaccttgaaagaagacaggtgttctgtctgctcctgcaag
gatggcaagatattctgccgacggacagcttgtgattgccagaatccaagtgctgaccta
ttctgttgcccagaatgtgacaccagagtcacaagtcaatgtttagaccaaaatggtcac
aagctgtatcgaagtggagacaattggacccatagctgtcagcagtgtcggtgtctggaa
ggagaggtagattgctggccactcacttgccccaacttgagctgtgagtatacagctatc
ttagaaggggaatgttgtccccgctgtgtcagtgacccctgcctagctgataacatcacc
tatgacatcagaaaaacttgcctggacagctatggtgtttcacggcttagtggctcagtg
tggacgatggctggatctccctgcacaacctgtaaatgcaagaatggaagagtctgttgt
tctgtggattttgagtgtcttcaaaataattga

DBGET integrated database retrieval system