KEGG   Homo sapiens (human): 4750Help
Entry
4750              CDS       T01001                                 

Gene name
NEK1, NY-REN-55, SRPS2, SRPS2A, SRTD6
Definition
(RefSeq) NIMA related kinase 1 (EC:2.7.11.1)
  KO
K08857  
NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00511  
Short rib-polydactyly syndrome
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4750 (NEK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NEK family
   4750 (NEK1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4750 (NEK1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    4750 (NEK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q33
AA seq 1258 aa AA seqDB search
MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKH
PNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVH
DRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPY
NNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFK
RNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTFSKFGSQPIPAKRPASGQNSI
SVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISE
EAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGE
VKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGIL
PGVRPGFPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQR
KREAMQNKARAEGHMVYLARLRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADM
RRKKIESLKAHANARAAVLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHE
TGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENL
KAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFS
TTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEG
EKYKPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLET
EILQEPSGTNKDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSD
IHIEPGTNDSQHSKCDVDKSVQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSH
LPPKNKNKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVRQDNLEID
EIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQPGEEYSEEEESVLKNSDVEP
TANGTDVADEDDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELRLHLEQEMGFE
KFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADGAYQEDNDE
NT seq 3777 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtatgttagactacagaagattggagaaggttcatttggaaaagccattctt
gttaaatctacagaagatggcagacagtatgttatcaaggaaattaacatctcaagaatg
tccagtaaagaaagagaagaatcaaggagagaagttgcagtattggcaaacatgaagcat
ccaaatattgtccagtatagagaatcatttgaagaaaatggctctctctacatagtaatg
gattactgtgagggaggggatctgtttaagcgaataaatgctcagaaaggcgttttgttt
caagaggatcagattttggactggtttgtacagatatgtttggccctgaaacatgtacat
gatagaaaaattcttcatcgagacattaaatctcagaacatatttttaactaaagatgga
acagtacaacttggagattttggaattgctagagttcttaatagtactgtagagctggct
cgaacttgcatagggaccccatactacttgtcacctgaaatctgtgaaaacaaaccttac
aataataaaagtgacatttgggctctggggtgtgtcctttatgagctgtgtacacttaaa
catgcttttgaagctggcagtatgaaaaacctggtactgaagataatatctggatctttt
ccacctgtgtctttgcattattcctatgatctccgcagtttggtgtctcagttatttaaa
agaaatcctagggatagaccatcagtcaactccatattggagaaaggttttatagccaaa
cgcattgaaaagtttctctctcctcagcttattgcagaagaattttgtctaaaaacattt
tcgaagtttggatcacagcctataccagctaaaagaccagcttcaggacaaaactcgatt
tctgttatgcctgctcagaaaattacaaagcctgccgctaaatatggaatacctttagca
tataagaaatatggagataaaaaattacacgaaaagaaaccactgcaaaaacataaacag
gcccatcaaactccagagaagagagtgaatactggagaagaaaggaggaaaatatctgag
gaagcagcaagaaagagaaggctggaatttattgaaaaagaaaagaaacaaaaggatcag
attattagtttaatgaaggctgaacaaatgaaaaggcaagaaaaggaaaggttggaaaga
ataaatagggccagggaacaaggatggagaaatgtgctaagtgctggtggaagtggtgaa
gtaaaggctccttttctgggcagtggagggactatagctccatcatctttttcttctcga
ggacagtatgaacattaccatgccatttttgaccaaatgcagcaacaaagagcagaagat
aatgaagctaaatggaaaagagaaatatatggtcgaggtcttccagaaagaggaattctg
cctggagttcgtccaggatttccttatggggctgcaggtcatcaccattttcctgatgct
gatgatattagaaaaactttgaaaagattgaaggcggtgtctaaacaagccaatgcaaac
aggcaaaaagggcagctagctgtagaaagagctaaacaagtagaagagttcctgcagcga
aaacgggaagctatgcagaataaagctcgagccgaaggacatatggtttatctggcaaga
ctgaggcaaataagactacagaatttcaatgagcgccaacagattaaagccaaacttcgt
ggtgaaaagaaagaagctaatcattctgaaggacaagaaggaagtgaagaggctgacatg
aggcgcaaaaaaatcgaatcactgaaggcccatgcaaatgcacgtgctgctgtactaaaa
gaacaactagaacgaaagagaaaggaggcttatgagagagaaaaaaaagtgtgggaagag
catttggtggctaaaggagttaagagttctgatgtttctccacctttgggacagcatgaa
acaggtggctctccatcaaagcaacagatgagatctgttatttctgtaacttcagctttg
aaagaagttggcgtggacagtagtttaactgatacccgggaaacttcagaagagatgcaa
aagaccaacaatgctatttcaagtaagcgagaaatacttcgtagattaaatgaaaatctt
aaagctcaagaagatgaaaaaggaaagcagaatctctctgatacttttgagataaatgtt
catgaagatgccaaagagcatgaaaaagaaaaatcagtttcatctgatcgcaagaagtgg
gaggcaggaggtcaacttgtgattcctctggatgagttaacactagatacatccttctct
acaactgaaagacatacagtgggagaagttattaaattaggtcctaatggatctccaaga
agagcctgggggaaaagtccgacagattctgttctaaagatacttggagaagctgaacta
caacttcagacagaactattagaaaatacaactattagaagtgagatttctcccgaaggg
gaaaagtacaaacccttaattactggagaaaaaaaagtacaatgtatttcacatgaaata
aacccatcagctattgttgattctcctgttgagacaaaaagtcccgagttcagtgaggca
tctccacagatgtcattgaaactggaaggaaatttagaagaacctgatgatttggaaaca
gaaattctacaagagccaagtggaacaaacaaagatgagagcttgccatgcactattact
gatgtgtggattagtgaggaaaaagaaacaaaggaaactcagtcggcagataggatcacc
attcaggaaaatgaagtttctgaagatggagtctcgagtactgtggaccaacttagtgac
attcatatagagcctggaaccaatgattctcagcactctaaatgtgatgtagataagtct
gtgcaaccggaaccatttttccataaggtggttcattctgaacacttgaacttagtccct
caagttcaatcagttcagtgttcaccagaagaatcctttgcatttcgatctcactcgcat
ttaccaccaaaaaataaaaacaagaattccttgctgattggactttcaactggtctgttt
gatgcaaacaacccaaagatgttaaggacatgttcacttccagatctctcaaagctgttc
agaacccttatggatgttcccaccgtaggagatgttcgtcaagacaatcttgaaatagat
gaaattgaagatgaaaacattaaagaaggaccttctgattctgaagacattgtgtttgaa
gaaactgacacagatttacaagagctgcaggcctcgatggaacagttacttagggaacaa
cctggtgaagaatacagtgaagaagaagagtcagtcttgaagaacagtgatgtggagcca
actgcaaatgggacagatgtggcagatgaagatgacaatcccagcagtgaaagtgccctg
aacgaagaatggcactcagataacagtgatggtgaaattgctagtgaatgtgaatgcgat
agtgtctttaaccatttagaggaactgagacttcatctggagcaggaaatgggctttgaa
aaattctttgaggtttatgagaaaataaaggctattcatgaagatgaagatgaaaatatt
gaaatttgttcaaaaatagttcaaaatattttgggaaatgaacatcagcatctttatgcc
aagattcttcatttagtcatggcagatggagcctaccaagaagataatgatgaataa

DBGET integrated database retrieval system