KEGG   Homo sapiens (human): 4751Help
Entry
4751              CDS       T01001                                 

Gene name
NEK2, HsPK21, NEK2A, NLK1, PPP1R111, RP67
Definition
(RefSeq) NIMA related kinase 2
  KO
K20872  
NIMA (never in mitosis gene a)-related kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4751 (NEK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NEK family
   4751 (NEK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4751 (NEK2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     4751 (NEK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.3
AA seq 445 aa AA seqDB search
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccgggctgaggactatgaagtgttgtacaccattggcacaggctcctacggc
cgctgccagaagatccggaggaagagtgatggcaagatattagtttggaaagaacttgac
tatggctccatgacagaagctgagaaacagatgcttgtttctgaagtgaatttgcttcgt
gaactgaaacatccaaacatcgttcgttactatgatcggattattgaccggaccaataca
acactgtacattgtaatggaatattgtgaaggaggggatctggctagtgtaattacaaag
ggaaccaaggaaaggcaatacttagatgaagagtttgttcttcgagtgatgactcagttg
actctggccctgaaggaatgccacagacgaagtgatggtggtcataccgtattgcatcgg
gatctgaaaccagccaatgttttcctggatggcaagcaaaacgtcaagcttggagacttt
gggctagctagaatattaaaccatgacacgagttttgcaaaaacatttgttggcacacct
tattacatgtctcctgaacaaatgaatcgcatgtcctacaatgagaaatcagatatctgg
tcattgggctgcttgctgtatgagttatgtgcattaatgcctccatttacagcttttagc
cagaaagaactcgctgggaaaatcagagaaggcaaattcaggcgaattccataccgttac
tctgatgaattgaatgaaattattacgaggatgttaaacttaaaggattaccatcgacct
tctgttgaagaaattcttgagaaccctttaatagcagatttggttgcagacgagcaaaga
agaaatcttgagagaagagggcgacaattaggagagccagaaaaatcgcaggattccagc
cctgtattgagtgagctgaaactgaaggaaattcagttacaggagcgagagcgagctctc
aaagcaagagaagaaagattggagcagaaagaacaggagctttgtgttcgtgagagacta
gcagaggacaaactggctagagcagaaaatctgttgaagaactacagcttgctaaaggaa
cggaagttcctgtctctggcaagtaatccagaacttcttaatcttccatcctcagtaatt
aagaagaaagttcatttcagtggggaaagtaaagagaacatcatgaggagtgagaattct
gagagtcagctcacatctaagtccaagtgcaaggacctgaagaaaaggcttcacgctgcc
cagctgcgggctcaagccctgtcagatattgagaaaaattaccaactgaaaagcagacag
atcctgggcatgcgctag

DBGET integrated database retrieval system