KEGG   Homo sapiens (human): 4752Help
Entry
4752              CDS       T01001                                 

Gene name
NEK3, HSPK36
Definition
(RefSeq) NIMA related kinase 3
  KO
K20873  NIMA (never in mitosis gene a)-related kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4752 (NEK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NEK family
   4752 (NEK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     4752 (NEK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 4752
NCBI-ProteinID: NP_002489
OMIM: 604044
HGNC: 7746
Ensembl: ENSG00000136098
Vega: OTTHUMG00000016958
Pharos: P51956(Tbio)
UniProt: P51956
Position
13q14.3
AA seq 506 aa AA seqDB search
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHP
NIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHK
KRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYN
NKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKR
NPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI
ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHR
RQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTD
FEEEDDNPDWVSELKKRAGWQGLCDR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatgactacatggtcctgagaatgattggggagggctccttcggcagagctcttttg
gttcagcatgaaagcagtaatcagatgtttgccatgaaagaaataaggcttcccaagtct
ttctctaatacacagaattctaggaaggaggctgttcttttagccaaaatgaaacaccct
aatattgttgccttcaaagaatcatttgaagctgaaggacacttgtatattgtgatggaa
tactgtgatggaggggatctaatgcaaaagattaaacagcagaaaggaaagttatttcct
gaagacatgatacttaattggtttacccaaatgtgccttggagtaaatcacattcacaag
aaacgtgtgctacacagagatatcaagtccaagaatatcttcctcactcagaatggaaaa
gtgaaattgggagactttggatctgcccgtcttctctccaatccgatggcatttgcttgt
acctatgtgggaactccttattatgtgcctccagaaatttgggaaaacctgccttataac
aataaaagtgacatctggtccttgggttgcatcctgtatgaactctgtacccttaagcat
ccatttcaggcaaatagttggaaaaatcttatcctcaaagtatgtcaagggtgcatcagt
ccactgccgtctcattactcctatgaacttcagttcctagtcaagcagatgtttaaaagg
aatccctcacatcgcccctcggctacaacgcttctctctcgaggcatcgtagctcggctt
gtccagaagtgcttaccccccgagatcatcatggaatatggtgaggaagtattagaagaa
ataaaaaattcgaagcataacacaccaagaaaaaaaacaaaccccagcagaatcaggata
gctttgggaaatgaagcaagcacagtgcaagaggaagaacaagatagaaagggtagccat
actgatttggaaagcattaatgaaaatttagttgaaagtgcattgagaagagtaaacaga
gaagaaaaaggtaataagtcagtccatctgaggaaagccagttcaccaaatcttcataga
cgacagtgggagaaaaatgtacccaatacagctcttacagctttggaaaatgcatccata
ctcacctccagtttaacagcagaggacgatagaggtggttctgtaataaagtacagcaaa
aatactactcgtaagcagtggctcaaagagacccctgacactttgttgaacatccttaag
aatgctgatctcagcttggcttttcaaacatacacaatatatagaccaggttcagaaggg
ttcttgaaaggccccctgtctgaagaaacagaagcatcggacagtgttgatggaggtcac
gattctgtcattttggatccagagcgacttgagcctgggctagatgaggaggacacggac
tttgaggaggaagatgacaaccccgactgggtgtcagagctgaagaagcgagctggatgg
caaggcctgtgcgacagataa

DBGET integrated database retrieval system