KEGG   Homo sapiens (human): 4752Help
Entry
4752              CDS       T01001                                 

Gene name
NEK3, HSPK36
Definition
(RefSeq) NIMA related kinase 3 (EC:2.7.11.1)
  KO
K20873  
NIMA (never in mitosis gene a)-related kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4752 (NEK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NEK family
   4752 (NEK3)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     4752 (NEK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14.13
AA seq 506 aa AA seqDB search
MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHP
NIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHK
KRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYN
NKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKR
NPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI
ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHR
RQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTD
FEEEDDNPDWVSELKKRAGWQGLCDR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatgactacatggtcctgagaatgattggggagggctccttcggcagagctcttttg
gttcagcatgaaagcagtaatcagatgtttgccatgaaagaaataaggcttcccaagtct
ttctctaatacacagaattctaggaaggaggctgttcttttagccaaaatgaaacaccct
aatattgttgccttcaaagaatcatttgaagctgaaggacacttgtatattgtgatggaa
tactgtgatggaggggatctaatgcaaaagattaaacagcagaaaggaaagttatttcct
gaagacatgatacttaattggtttacccaaatgtgccttggagtaaatcacattcacaag
aaacgtgtgctacacagagatatcaagtccaagaatatcttcctcactcagaatggaaaa
gtgaaattgggagactttggatctgcccgtcttctctccaatccgatggcatttgcttgt
acctatgtgggaactccttattatgtgcctccagaaatttgggaaaacctgccttataac
aataaaagtgacatctggtccttgggttgcatcctgtatgaactctgtacccttaagcat
ccatttcaggcaaatagttggaaaaatcttatcctcaaagtatgtcaagggtgcatcagt
ccactgccgtctcattactcctatgaacttcagttcctagtcaagcagatgtttaaaagg
aatccctcacatcgcccctcggctacaacgcttctctctcgaggcatcgtagctcggctt
gtccagaagtgcttaccccccgagatcatcatggaatatggtgaggaagtattagaagaa
ataaaaaattcgaagcataacacaccaagaaaaaaaacaaaccccagcagaatcaggata
gctttgggaaatgaagcaagcacagtgcaagaggaagaacaagatagaaagggtagccat
actgatttggaaagcattaatgaaaatttagttgaaagtgcattgagaagagtaaacaga
gaagaaaaaggtaataagtcagtccatctgaggaaagccagttcaccaaatcttcataga
cgacagtgggagaaaaatgtacccaatacagctcttacagctttggaaaatgcatccata
ctcacctccagtttaacagcagaggacgatagaggtggttctgtaataaagtacagcaaa
aatactactcgtaagcagtggctcaaagagacccctgacactttgttgaacatccttaag
aatgctgatctcagcttggcttttcaaacatacacaatatatagaccaggttcagaaggg
ttcttgaaaggccccctgtctgaagaaacagaagcatcggacagtgttgatggaggtcac
gattctgtcattttggatccagagcgacttgagcctgggctagatgaggaggacacggac
tttgaggaggaagatgacaaccccgactgggtgtcagagctgaagaagcgagctggatgg
caaggcctgtgcgacagataa

DBGET integrated database retrieval system