KEGG   Homo sapiens (human): 4774Help
Entry
4774              CDS       T01001                                 

Gene name
NFIA, CTF, NF-I/A, NF1-A, NFI-A, NFI-L
Definition
(RefSeq) nuclear factor I/A
  KO
K09168  
nuclear factor I/A
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other basic domains
   NF-1
    4774 (NFIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3-p31.2
AA seq 509 aa AA seqDB search
MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDEL
LSEKPEVKQKWASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLA
YFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGT
GPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKSVEDEMDSPGEEPFYTGQGRS
PGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRAS
PHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPST
SPANRFVSVGPRDPSFVNIPQQTQSWYLG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtattctccgctctgtctcacccaggatgaatttcatcctttcatcgaagcacttctg
ccccacgtccgagcctttgcctacacatggttcaacctgcaggcccgaaaacgaaaatac
ttcaaaaaacatgaaaagcgtatgtcaaaagaagaagagagagccgtgaaggatgaattg
ctaagtgaaaaaccagaggtcaagcagaagtgggcatctcgacttctggcaaagttgcgg
aaagatatccgacccgaatatcgagaggattttgttcttacagttacagggaaaaaacct
ccatgttgtgttctttccaacccagaccagaaaggcaagatgcgaagaattgactgcctc
cgccaggcagataaagtctggaggttggaccttgttatggtgattttgtttaaaggtatt
ccgctggaaagtactgatggcgagcgccttgtaaagtccccacaatgctctaatccaggg
ctctgtgtccaaccccatcacataggggtttctgttaaggaactcgatttatatttggca
tactttgtgcatgcagcagattcaagtcaatctgaaagtcccagccagccaagtgacgct
gacattaaggaccagccagaaaatggacatttgggcttccaggacagttttgtcacatca
ggtgtttttagtgtcactgagctagtaagagtgtcacagacaccaatagctgcaggaact
ggcccaaatttttctctctcagatttggaaagttcttcatactacagcatgagtccagga
gcaatgaggaggtctttacccagcacatcctctacgagctccacaaagcgcctcaagtct
gtggaggatgaaatggacagtcctggtgaggagccattttatacaggccaagggcgctcc
ccaggaagtggcagtcagtcaagtggatggcatgaagtggagccaggaatgccatctcca
accacactgaagaagtcggagaagtctggtttcagcagcccctccccttcacagacctcc
tccctgggaacggcgttcacacagcatcaccgacctgtcattacaggacccagagcaagt
ccgcatgcaacaccatcgactcttcatttcccgacatcacccattatccagcagcctggg
ccttacttctcacacccagccatccgctatcaccctcaggagacgctgaaagaatttgtc
caacttgtctgccctgatgctggtcagcaggctggacaggtggggttcctcaatcccaat
gggagcagccaaggcaaggtgcacaacccattccttcccaccccaatgttgccaccgcca
ccgccaccaccgatggccaggcctgtgcctctgccggtgccagacacaaagcctccaacc
acgtcaacagaaggaggtgcagcctcccccacgtcaccaacctactcgacacccagcacc
tcccccgcaaaccgattcgtcagtgttggaccacgggatccaagctttgtaaatatccct
caacagacacagtcctggtacctgggataa

DBGET integrated database retrieval system