KEGG   Homo sapiens (human): 4779Help
Entry
4779              CDS       T01001                                 

Gene name
NFE2L1, LCR-F1, NRF1, TCF11
Definition
nuclear factor, erythroid 2-like 1
Orthology
K09040  
nuclear factor erythroid 2-related factor 1/3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.3
AA seq 772 aa AA seqDB search
MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRN
TLDGYGIHPKSIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNS
GLALESSSGLQDVTGPDNGVRESETEQGFGEDLEDLGAVAPPVSGDLTKEDIDLIDILWR
QDIDLGAGREVFDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPA
QVPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSITEAVPSESEPPALQNNLLSPL
LTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYSLAPNTPINQN
VSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP
QLNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLS
LDSSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEG
AVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSK
EKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRR
RGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQE
VFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgaagaaatacttaacggaaggacttctccagttcaccattctgctgagt
ttgattggggtacgggtggacgtggatacttacctgacctcacagcttcccccactccgg
gagatcatcctggggcccagttctgcctatactcagacccagttccacaacctgaggaat
accttggatggctatggtatccaccccaagagcatagacctggacaattacttcactgcc
cggcggctcctcagtcaggtgagggccctggacaggttccaggtgccaaccactgaggta
aatgcctggctggttcaccgagacccagaggggtctgtctctggcagtcagcccaactca
ggcctcgccctcgagagttccagtggcctccaagatgtgacaggcccagacaacggggtg
cgagaaagcgaaacggagcagggattcggtgaagatttggaggatttgggggctgtagcc
cccccagtcagtggagacttaaccaaagaggacatagatctgattgacatcctttggcga
caggatattgatctgggggctgggcgtgaggtttttgactatagtcaccgccagaaggag
caggatgtggagaaggagctgcgagatggaggcgagcaggacacctgggcaggcgagggc
gcggaagctctggcacggaacctgctagtggatggagagactggggagagcttccctgca
caggtgcctagtggggaggaccagacggccctgtccctggaagagtgccttaggctgctg
gaagccacctgcccctttggggagaatgctgagtttccagcagacatttccagcataaca
gaagcagtgcctagtgagagtgagccccctgctcttcaaaacaacctcttgtctcctctt
ctgaccgggacagagtcaccatttgatttggaacagcagtggcaagatctcatgtccatc
atggaaatgcaggccatggaagtgaacacatcagcaagtgaaatcctgtacagtgcccct
cctggagacccactgagcaccaactacagccttgcccccaacactcccatcaatcagaat
gtcagcctgcatcaggcgtccctggggggctgcagccaggacttcttactcttcagcccc
gaggtggaaagcctgcctgtggccagtagctccacgctgctcccgttggcccccagcaat
tctaccagcctcaactccaccttcggctccaccaacctgacagggctcttctttccaccc
cagctcaatggcacagccaatgacacagcaggcccagagctgcctgaccctttggggggt
ctgttagatgaagctatgttggatgagatcagccttatggacctggccattgaagaaggc
tttaaccctgtgcaggcctcccagctggaggaggaatttgactctgactcaggcctttcc
ttagactcgagccatagcccttcttccctaagcagctctgaaggcagttcttcctcttct
tcctcctcctcttcctcttcttcctctgcttcttcctctgcctcttcctccttttctgag
gaaggtgcggttggctacagctctgactctgagaccctggatctggaagaggccgagggt
gctgtgggctaccagcctgagtattccaagttctgccgcatgagctaccaggatccagct
cagctctcatgcctgccctacctggagcacgtgggccacaaccacacatacaacatggca
cccagtgccctggactcagccgacctgccaccacccagtgccctcaagaaaggcagcaag
gagaagcaggctgacttcctggacaagcagatgagccgggatgagcaccgagcccgagcc
atgaagatccctttcaccaatgacaaaatcatcaacctgcctgtggaggagttcaatgaa
ctgctgtccaaataccagttgagtgaagcccagctgagcctcatccgagacatccggcgc
cggggcaagaacaagatggcggcgcagaactgccgcaagcgcaagctggacaccatcctg
aatctggagcgtgatgtggaggacctgcagcgtgacaaagcccggctgctgcgggagaaa
gtggagttcctgcgctccctgcgacagatgaagcagaaggtccagagcctgtaccaggag
gtgtttgggcggctgcgagatgagaacggacgaccctactcgcccagtcagtatgcgctc
cagtacgccggggacggcagtgtcctcctcatcccccgcacgatggccgaccagcaggcc
cggcggcaggagaggaagccaaaggaccggagaaagtga

DBGET integrated database retrieval system