KEGG   Homo sapiens (human): 4780Help
Entry
4780              CDS       T01001                                 

Gene name
NFE2L2, NRF2
Definition
nuclear factor, erythroid 2-like 2
Orthology
K05638  
nuclear factor erythroid 2-related factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31
AA seq 589 aa AA seqDB search
MDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL
DEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVS
SATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPE
LQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSS
ILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGP
IDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDS
EVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGH
RKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLA
LIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQ
LSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggatttgattgacatactttggaggcaagatatagatcttggagtaagtcgagaagta
tttgacttcagtcagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaag
gaaagacaagaacaactccaaaaggagcaagagaaagcctttttcgctcagttacaacta
gatgaagagacaggtgaatttctcccaattcagccagcccagcacatccagtcagaaacc
agtggatctgccaactactcccaggttgcccacattcccaaatcagatgctttgtacttt
gatgactgcatgcagcttttggcgcagacattcccgtttgtagatgacaatgaggtttct
tcggctacgtttcagtcacttgttcctgatattcccggtcacatcgagagcccagtcttc
attgctactaatcaggctcagtcacctgaaacttctgttgctcaggtagcccctgttgat
ttagacggtatgcaacaggacattgagcaagtttgggaggagctattatccattcctgag
ttacagtgtcttaatattgaaaatgacaagctggttgagactaccatggttccaagtcca
gaagccaaactgacagaagttgacaattatcatttttactcatctataccctcaatggaa
aaagaagtaggtaactgtagtccacattttcttaatgcttttgaggattccttcagcagc
atcctctccacagaagaccccaaccagttgacagtgaactcattaaattcagatgccaca
gtcaacacagattttggtgatgaattttattctgctttcatagctgagcccagtatcagc
aacagcatgccctcacctgctactttaagccattcactctctgaacttctaaatgggccc
attgatgtttctgatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcaca
gcagaattcaatgattctgactccggcatttcactaaacacaagtcccagtgtggcatca
ccagaacactcagtggaatcttccagctatggagacacactacttggcctcagtgattct
gaagtggaagagctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacacca
gtacattcttctggggatatggtacaacccttgtcaccatctcaggggcagagcactcac
gtgcatgatgcccaatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcat
cggaaaaccccattcacaaaagacaaacattcaagccgcttggaggctcatctcacaaga
gatgaacttagggcaaaagctctccatatcccattccctgtagaaaaaatcattaacctc
cctgttgttgacttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgca
ttaattcgggatatacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaa
agaaaactggaaaatatagtagaactagagcaagatttagatcatttgaaagatgaaaaa
gaaaaattgctcaaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaa
ctcagcaccttatatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttat
tctcctagtgaatactccctgcagcaaacaagagatggcaatgttttccttgttcccaaa
agtaagaagccagatgttaagaaaaactag

DBGET integrated database retrieval system