KEGG   Homo sapiens (human): 4780Help
Entry
4780              CDS       T01001                                 

Gene name
NFE2L2, HEBP1, NRF2
Definition
(RefSeq) nuclear factor, erythroid 2 like 2
  KO
K05638  
nuclear factor erythroid 2-related factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4780 (NFE2L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    4780 (NFE2L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4780 (NFE2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31
AA seq 605 aa AA seqDB search
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttggagctgccgccgccgggactcccgtcccagcaggacatggatttgatt
gacatactttggaggcaagatatagatcttggagtaagtcgagaagtatttgacttcagt
cagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaaggaaagacaagaa
caactccaaaaggagcaagagaaagcctttttcgctcagttacaactagatgaagagaca
ggtgaatttctcccaattcagccagcccagcacatccagtcagaaaccagtggatctgcc
aactactcccaggttgcccacattcccaaatcagatgctttgtactttgatgactgcatg
cagcttttggcgcagacattcccgtttgtagatgacaatgaggtttcttcggctacgttt
cagtcacttgttcctgatattcccggtcacatcgagagcccagtcttcattgctactaat
caggctcagtcacctgaaacttctgttgctcaggtagcccctgttgatttagacggtatg
caacaggacattgagcaagtttgggaggagctattatccattcctgagttacagtgtctt
aatattgaaaatgacaagctggttgagactaccatggttccaagtccagaagccaaactg
acagaagttgacaattatcatttttactcatctataccctcaatggaaaaagaagtaggt
aactgtagtccacattttcttaatgcttttgaggattccttcagcagcatcctctccaca
gaagaccccaaccagttgacagtgaactcattaaattcagatgccacagtcaacacagat
tttggtgatgaattttattctgctttcatagctgagcccagtatcagcaacagcatgccc
tcacctgctactttaagccattcactctctgaacttctaaatgggcccattgatgtttct
gatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcacagcagaattcaat
gattctgactccggcatttcactaaacacaagtcccagtgtggcatcaccagaacactca
gtggaatcttccagctatggagacacactacttggcctcagtgattctgaagtggaagag
ctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacaccagtacattcttct
ggggatatggtacaacccttgtcaccatctcaggggcagagcactcacgtgcatgatgcc
caatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcatcggaaaacccca
ttcacaaaagacaaacattcaagccgcttggaggctcatctcacaagagatgaacttagg
gcaaaagctctccatatcccattccctgtagaaaaaatcattaacctccctgttgttgac
ttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgcattaattcgggat
atacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaaagaaaactggaa
aatatagtagaactagagcaagatttagatcatttgaaagatgaaaaagaaaaattgctc
aaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaactcagcacctta
tatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttattctcctagtgaa
tactccctgcagcaaacaagagatggcaatgttttccttgttcccaaaagtaagaagcca
gatgttaagaaaaactag

DBGET integrated database retrieval system