KEGG   Homo sapiens (human): 4780Help
Entry
4780              CDS       T01001                                 

Gene name
NFE2L2, HEBP1, NRF2
Definition
(RefSeq) nuclear factor, erythroid 2 like 2
  KO
K05638  
nuclear factor erythroid 2-related factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Pathways in cancer
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Disease
H00048  
Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4780 (NFE2L2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4780 (NFE2L2)
   05225 Hepatocellular carcinoma
    4780 (NFE2L2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4780 (NFE2L2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    4780 (NFE2L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4780 (NFE2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16236(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.2
AA seq 605 aa AA seqDB search
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttggagctgccgccgccgggactcccgtcccagcaggacatggatttgatt
gacatactttggaggcaagatatagatcttggagtaagtcgagaagtatttgacttcagt
cagcgacggaaagagtatgagctggaaaaacagaaaaaacttgaaaaggaaagacaagaa
caactccaaaaggagcaagagaaagcctttttcgctcagttacaactagatgaagagaca
ggtgaatttctcccaattcagccagcccagcacatccagtcagaaaccagtggatctgcc
aactactcccaggttgcccacattcccaaatcagatgctttgtactttgatgactgcatg
cagcttttggcgcagacattcccgtttgtagatgacaatgaggtttcttcggctacgttt
cagtcacttgttcctgatattcccggtcacatcgagagcccagtcttcattgctactaat
caggctcagtcacctgaaacttctgttgctcaggtagcccctgttgatttagacggtatg
caacaggacattgagcaagtttgggaggagctattatccattcctgagttacagtgtctt
aatattgaaaatgacaagctggttgagactaccatggttccaagtccagaagccaaactg
acagaagttgacaattatcatttttactcatctataccctcaatggaaaaagaagtaggt
aactgtagtccacattttcttaatgcttttgaggattccttcagcagcatcctctccaca
gaagaccccaaccagttgacagtgaactcattaaattcagatgccacagtcaacacagat
tttggtgatgaattttattctgctttcatagctgagcccagtatcagcaacagcatgccc
tcacctgctactttaagccattcactctctgaacttctaaatgggcccattgatgtttct
gatctatcactttgcaaagctttcaaccaaaaccaccctgaaagcacagcagaattcaat
gattctgactccggcatttcactaaacacaagtcccagtgtggcatcaccagaacactca
gtggaatcttccagctatggagacacactacttggcctcagtgattctgaagtggaagag
ctagatagtgcccctggaagtgtcaaacagaatggtcctaaaacaccagtacattcttct
ggggatatggtacaacccttgtcaccatctcaggggcagagcactcacgtgcatgatgcc
caatgtgagaacacaccagagaaagaattgcctgtaagtcctggtcatcggaaaacccca
ttcacaaaagacaaacattcaagccgcttggaggctcatctcacaagagatgaacttagg
gcaaaagctctccatatcccattccctgtagaaaaaatcattaacctccctgttgttgac
ttcaacgaaatgatgtccaaagagcagttcaatgaagctcaacttgcattaattcgggat
atacgtaggaggggtaagaataaagtggctgctcagaattgcagaaaaagaaaactggaa
aatatagtagaactagagcaagatttagatcatttgaaagatgaaaaagaaaaattgctc
aaagaaaaaggagaaaatgacaaaagccttcacctactgaaaaaacaactcagcacctta
tatctcgaagttttcagcatgctacgtgatgaagatggaaaaccttattctcctagtgaa
tactccctgcagcaaacaagagatggcaatgttttccttgttcccaaaagtaagaagcca
gatgttaagaaaaactag

DBGET integrated database retrieval system