KEGG   Homo sapiens (human): 479Help
Entry
479               CDS       T01001                                 

Gene name
ATP12A, #945, ATP1AL1, HK
Definition
(RefSeq) ATPase H+/K+ transporting non-gastric alpha2 subunit (EC:3.6.3.10)
  KO
K01544  
non-gastric H+/K+-exchanging ATPase [EC:3.6.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    479 (ATP12A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.10  H+/K+-exchanging ATPase
     479 (ATP12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.12; 13q12.1-q12.3
AA seq 1039 aa AA seqDB search
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHK
LSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLW
VGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMI
PQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQ
PRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRTIIGHIASLASGVGNEKTPIA
IEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLATVTVTLS
LTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILG
DVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMING
EEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCF
VGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIA
HRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGC
QRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEG
RLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLIN
LRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIF
QQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEV
RKLFIRLYPGSWWDKNMYY
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagaaaaccccagaaatttactccgtggagctcagcggaactaaggacatcgtg
aaaacagacaagggggatggcaaggagaagtataggggtctgaagaacaactgcctggaa
ctcaaaaagaaaaatcacaaagaggagtttcagaaagaactccatctggatgaccacaaa
ctcagcaatagggaattggaagagaaatatggcacagacatcattatgggtctctccagc
accagagctgccgagctcctggcccgggatgggcccaactccctcacccctcccaagcag
acgcctgagatcgtcaagttcctcaagcagatggtgggggggttctctatcctcctgtgg
gtgggcgcctttctctgttggattgcatatgggattcagtactccagcgacaagtctgca
tccctgaacaacgtgtacttgggctgtgtgcttggtctggtggtcattttaacggggatc
tttgcttattaccaagaggcaaaaagcaccaacatcatgtccagcttcaataagatgatc
cctcagcaagctctcgtcatccgagattccgagaagaagaccatcccttcagagcagctg
gtggtgggggacattgtggaggtcaaaggaggagaccagatccctgcagacatcagggtg
ctgtcttctcaggggtgtcgggtggataactcatctctcacgggggagtctgagccccag
ccccgctcctctgagtttacccatgaaaaccccctggaaacaaagaacatctgcttctat
tccacaacgtgtctggaaggcactgtcaccggcatggttatcaacacgggtgaccgcacc
atcattggccatattgcctcattggcctcaggagttggaaatgagaagacgcccattgcc
attgagatcgagcactttgttcacattgtggcaggagtggctgtctccatcggcatcctt
ttcttcatcatcgctgtgtccctgaagtatcaagtcctggactccatcatcttcctcatt
ggcatcattgtggccaatgtgcccgagggcctcctggccactgtcactgtgaccctgtcg
ctgacagcaaaacggatggccaagaagaactgcctggtgaagaacctggaggctgtggag
accctcggctccacctccatcatctgctcggacaagactgggacactgacccagaacagg
atgacagtggcccatctgtggttcgacaatcagatctttgtggctgacaccagtgaggac
cattcaaaccaagtctttgaccaaagctctaggacttgggcctccttatccaagataata
acattgtgtaaccgagcagagttcaagccaggacaggaaaatgtccccatcatgaagaaa
gctgtgattggagatgcctcagaaactgctcttttaaaattctcagaggtcattttgggt
gatgtgatggaaattagaaaaagaaaccgcaaagtagctgaaatcccttttaactctact
aataaatttcagctctccatccacgagatggatgacccccacggcaagcgcttcctcatg
gtgatgaagggggcccctgagcgcatcctagagaaatgcagcaccatcatgatcaacggc
gaggagcacccactggacaagagcactgccaagaccttccacacagcctacatggagctg
ggcgggttgggcgagcgtgtgctgggtttctgtcatctctacctgccagcagacgagttt
ccagaaacctactcatttgacatagacgctatgaactttccgacctccaacctctgtttt
gtgggactcttgtcaatgatcgatccccctcggtccaccgtgccagatgcagtcaccaaa
tgccggagtgcagggatcaaggttattatggttactggtgatcatcccatcacagccaaa
gctattgccaagagtgtggggatcatttcagccaacagtgaaacagtggaagacattgca
catcgcctcaacattgctgtggagcaagttaacaaacgggatgccaaggccgctgtggtg
actggcatggagctgaaggacatgagctcagaacagctggatgagatcttagccaactac
caggagattgtctttgcccggacatccccccagcagaagctgatcattgtggagggctgt
cagaggcaggatgctgttgttgctgtgaccggggatggagttaatgactctccggctcta
aagaaggcagacattgggattgccatggggatagcaggttctgatgcagccaaaaatgca
gccgacatggtcttgctggacgacaacttcgcatccatcgtcacaggggtggaggaaggt
cgcctgatctttgacaacctcaagaagactattgcttattccctgaccaagaacattgcc
gagctgtgcccctttctgatctacatcattgtcgggctccccctgcccattggcaccatc
accattctgttcattgacttggggacagacattatcccctccattgccttggcgtacgag
aaagctgaaagtgacatcatgaacaggaagcctcgccacaagaataaggacaggctggtg
aaccagccgctcgctgtgtactcatacctgcacattggcctcatgcaagccctgggagct
ttccttgtgtatttcaccgtctatgcacaagagggctttctgccccgcactctcattaac
ctgcgggtagaatgggagaaggactacgtgaatgacttgaaagacagctatgggcaggaa
tggacaaggtaccagagggaatacctagaatggacgggctacacggctttctttgttggc
atcctagtccagcaaatagcagatctgatcatcaggaaaacccggaggaattccatcttc
cagcagggtctcttcagaaataaagtcatctgggtggggatcacctcacagatcatcatt
ggtctgatcctctcctatggcctcggaagtgtcacagccttgagtttcaccatgcttagg
gctcagtactggtttgtggctgtgccgcacgccatcctgatctgggtgtatgatgaggtg
cggaagctcttcatcaggctctaccctggaagctggtgggataagaacatgtattattaa

DBGET integrated database retrieval system