KEGG   Homo sapiens (human): 479Help
Entry
479               CDS       T01001                                 

Gene name
ATP12A, ATP1AL1
Definition
ATPase, H+/K+ transporting, nongastric, alpha polypeptide (EC:3.6.3.10)
Orthology
K01544  
non-gastric H+/K+-exchanging ATPase [EC:3.6.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.12; 13q12.1-q12.3
AA seq 1045 aa AA seqDB search
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHK
LSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLW
VGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMI
PQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQ
PRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVINTGDRTIIGHIASLASGVGN
EKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLAT
VTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFV
ADTSEDHSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKF
SEVILGDVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCS
TIMINGEEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFP
TSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSE
TVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKL
IIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIV
TGVEEGRLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPS
IALAYEKAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFL
PRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKT
RRNSIFQQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILI
WVYDEVRKLFIRLYPGSWWDKNMYY
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagaaaaccccagaaatttactccgtggagctcagcggaactaaggacatcgtg
aaaacagacaagggggatggcaaggagaagtataggggtctgaagaacaactgcctggaa
ctcaaaaagaaaaatcacaaagaggagtttcagaaagaactccatctggatgaccacaaa
ctcagcaatagggaattggaagagaaatatggcacagacatcattatgggtctctccagc
accagagctgccgagctcctggcccgggatgggcccaactccctcacccctcccaagcag
acgcctgagatcgtcaagttcctcaagcagatggtgggggggttctctatcctcctgtgg
gtgggcgcctttctctgttggattgcatatgggattcagtactccagcgacaagtctgca
tccctgaacaacgtgtacttgggctgtgtgcttggtctggtggtcattttaacggggatc
tttgcttattaccaagaggcaaaaagcaccaacatcatgtccagcttcaataagatgatc
cctcagcaagctctcgtcatccgagattccgagaagaagaccatcccttcagagcagctg
gtggtgggggacattgtggaggtcaaaggaggagaccagatccctgcagacatcagggtg
ctgtcttctcaggggtgtcgggtggataactcatctctcacgggggagtctgagccccag
ccccgctcctctgagtttacccatgaaaaccccctggaaacaaagaacatctgcttctat
tccacaacgtgtctggaagcatctacttcccctgtaggcactgtcaccggcatggttatc
aacacgggtgaccgcaccatcattggccatattgcctcattggcctcaggagttggaaat
gagaagacgcccattgccattgagatcgagcactttgttcacattgtggcaggagtggct
gtctccatcggcatccttttcttcatcatcgctgtgtccctgaagtatcaagtcctggac
tccatcatcttcctcattggcatcattgtggccaatgtgcccgagggcctcctggccact
gtcactgtgaccctgtcgctgacagcaaaacggatggccaagaagaactgcctggtgaag
aacctggaggctgtggagaccctcggctccacctccatcatctgctcggacaagactggg
acactgacccagaacaggatgacagtggcccatctgtggttcgacaatcagatctttgtg
gctgacaccagtgaggaccattcaaaccaagtctttgaccaaagctctaggacttgggcc
tccttatccaagataataacattgtgtaaccgagcagagttcaagccaggacaggaaaat
gtccccatcatgaagaaagctgtgattggagatgcctcagaaactgctcttttaaaattc
tcagaggtcattttgggtgatgtgatggaaattagaaaaagaaaccgcaaagtagctgaa
atcccttttaactctactaataaatttcagctctccatccacgagatggatgacccccac
ggcaagcgcttcctcatggtgatgaagggggcccctgagcgcatcctagagaaatgcagc
accatcatgatcaacggcgaggagcacccactggacaagagcactgccaagaccttccac
acagcctacatggagctgggcgggttgggcgagcgtgtgctgggtttctgtcatctctac
ctgccagcagacgagtttccagaaacctactcatttgacatagacgctatgaactttccg
acctccaacctctgttttgtgggactcttgtcaatgatcgatccccctcggtccaccgtg
ccagatgcagtcaccaaatgccggagtgcagggatcaaggttattatggttactggtgat
catcccatcacagccaaagctattgccaagagtgtggggatcatttcagccaacagtgaa
acagtggaagacattgcacatcgcctcaacattgctgtggagcaagttaacaaacgggat
gccaaggccgctgtggtgactggcatggagctgaaggacatgagctcagaacagctggat
gagatcttagccaactaccaggagattgtctttgcccggacatccccccagcagaagctg
atcattgtggagggctgtcagaggcaggatgctgttgttgctgtgaccggggatggagtt
aatgactctccggctctaaagaaggcagacattgggattgccatggggatagcaggttct
gatgcagccaaaaatgcagccgacatggtcttgctggacgacaacttcgcatccatcgtc
acaggggtggaggaaggtcgcctgatctttgacaacctcaagaagactattgcttattcc
ctgaccaagaacattgccgagctgtgcccctttctgatctacatcattgtcgggctcccc
ctgcccattggcaccatcaccattctgttcattgacttggggacagacattatcccctcc
attgccttggcgtacgagaaagctgaaagtgacatcatgaacaggaagcctcgccacaag
aataaggacaggctggtgaaccagccgctcgctgtgtactcatacctgcacattggcctc
atgcaagccctgggagctttccttgtgtatttcaccgtctatgcacaagagggctttctg
ccccgcactctcattaacctgcgggtagaatgggagaaggactacgtgaatgacttgaaa
gacagctatgggcaggaatggacaaggtaccagagggaatacctagaatggacgggctac
acggctttctttgttggcatcctagtccagcaaatagcagatctgatcatcaggaaaacc
cggaggaattccatcttccagcagggtctcttcagaaataaagtcatctgggtggggatc
acctcacagatcatcattggtctgatcctctcctatggcctcggaagtgtcacagccttg
agtttcaccatgcttagggctcagtactggtttgtggctgtgccgcacgccatcctgatc
tgggtgtatgatgaggtgcggaagctcttcatcaggctctaccctggaagctggtgggat
aagaacatgtattattaa

DBGET integrated database retrieval system