KEGG   Homo sapiens (human): 4794Help
Entry
4794              CDS       T01001                                 

Gene name
NFKBIE, IKBE
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Orthology
K05872  
NF-kappa-B inhibitor epsilon
Organism
hsa  Homo sapiens (human)
Pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Epstein-Barr virus infection
Disease
H00007  
Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    4794 (NFKBIE)
   04662 B cell receptor signaling pathway
    4794 (NFKBIE)
  Endocrine system
   04920 Adipocytokine signaling pathway
    4794 (NFKBIE)
  Nervous system
   04722 Neurotrophin signaling pathway
    4794 (NFKBIE)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    4794 (NFKBIE)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4794 (NFKBIE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 500 aa AA seqDB search
MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRG
GGPAWAVRLPTVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAAR
RSLEPDPAQTGPRPARAAGMSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPS
DGSPQPCTHPPGPVKEPQEKEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPH
VGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHL
AVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHS
LDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
LVLLPFDDLKISGKLLLCTD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacgaaggagtgagtcaaggcccgggaaccacagactccaagcctacgcagag
cccgggaagggggattccggaggggcggggcctctttccggaagcgcccgccgggggcgg
ggagggggcggggccatccgcgtgaggcgaccctgttggtccggaggggcggggcgagga
ggaggacccgcttgggcggttcggctgcccacagtaaccgctgggtggacctggccagcg
ctccgaaccttgtcctcgctgcgcgccggcccctcggagccccacagcccgggaaggagg
ccgccgcgggccgggcgcccgctctgccaagcggacccgcaacccggaaaggcggcgcgg
cggagcctggagccggatcctgctcagaccgggccccggccggccagagccgcgggcatg
tcggaggcgcggaaggggccggacgaggcggaggagagccagtacgactctggcattgag
tctctgcgctctctgcgctccctacccgagtccacctcggctccagcctccgggccctcg
gacggcagcccccagccctgcacccatcctccgggacccgtcaaggaaccacaggagaag
gaagacgcggatggggagcgggctgattccacctatggctcctcctcgctcacctacacc
ctgtccttgctggggggccccgaggctgaggacccggccccacgcctgccactcccccac
gtgggggcgctgagccctcagcagctggaagcactcacttacatctccgaggacggagac
acgctggtccacctggcagtgattcatgaggccccagcggtgctgctctgttgcctggct
ttgctgccccaggaggtcctggacattcaaaataacctttaccagacagcactccatctg
gctgtacatctggaccaaccgggcgcagttcgggcactggtgctgaagggggccagccgg
gcactacaggaccggcatggtgacacagcccttcatgtggcctgccagcgccagcacttg
gcctgtgcccgctgcctgctggaagggcggccagagccaggcagaggaacatctcactct
ctggacctccagctgcaaaactggcaaggtctggcttgtctccacattgccacccttcag
aagaaccaaccactcatggaattgctgcttcggaatggagctgacattgatgtgcaggag
ggcaccagtggtaagacagcgctgcacctggctgtggaaacccaagagcggggcctggta
cagttcctgctccaggctggtgcccaggtagatgcccgcatgctgaacgggtgcacaccc
ctgcacctggcagctggccggggtctcatgggcatctcatccactctgtgcaaggcgggt
gctgactccctgctgcggaatgtggaggatgagacgccccaggacctgactgaggaatcc
cttgtccttttgccctttgatgacctgaagatctcagggaaactgctgctgtgtaccgac
tga

DBGET integrated database retrieval system