KEGG   Homo sapiens (human): 48Help
Entry
48                CDS       T01001                                 

Gene name
ACO1, ACONS, HEL60, IREB1, IREBP, IREBP1, IRP1
Definition
(RefSeq) aconitase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    48 (ACO1)
   00630 Glyoxylate and dicarboxylate metabolism
    48 (ACO1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     48 (ACO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 48
NCBI-ProteinID: NP_001265281
OMIM: 100880
HGNC: 117
Ensembl: ENSG00000122729
Vega: OTTHUMG00000019740
Pharos: P21399(Tbio)
UniProt: P21399 V9HWB7 Q9HBB2
Structure
PDB: 

Jmol
Position
9p21.1
AA seq 889 aa AA seqDB search
MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDI
ENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTY
YLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMA
RGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSR
DWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacccattcgcacaccttgctgagccattggatcctgtacaaccaggaaagaaa
ttcttcaatttgaataaattggaggattcaagatatgggcgcttaccattttcgatcaga
gttcttctggaagcagccattcggaattgtgatgagtttttggtgaagaaacaggatatt
gaaaatattctacattggaatgtcacgcagcacaagaacatagaagtgccatttaagcct
gctcgtgtcatcctgcaggactttacgggtgtgcccgctgtggttgactttgctgcaatg
cgtgatgctgtgaaaaagttaggaggagatccagagaaaataaaccctgtctgccctgct
gatcttgtaatagatcattccatccaggttgatttcaacagaagggcagacagtttacag
aagaatcaagacctggaatttgaaagaaatagagagcgatttgaatttttaaagtggggt
tcccaggcttttcacaacatgcggattattccccctggctcaggaatcatccaccaggtg
aatttggaatatttggcaagagtggtatttgatcaggatggatattattacccagacagc
ctcgtgggcacagactcgcacactaccatgattgatggcttgggcattcttggttggggt
gtcggtggtattgaagcagaagctgtcatgctgggtcagccaatcagtatggtgcttcct
caggtgattggctacaggctgatggggaagccccaccctctggtaacatccactgacatc
gtgctcaccattaccaagcacctccgccaggttggggtagtgggcaaatttgtcgagttc
ttcgggcctggagtagcccagttgtccattgctgaccgagctacgattgctaacatgtgt
ccagagtacggagcaactgctgcctttttcccagttgatgaagttagtatcacgtacctg
gtgcaaacaggtcgtgatgaagaaaaattaaagtatattaaaaaatatcttcaggctgta
ggaatgtttcgagatttcaatgacccttctcaagacccagacttcacccaggttgtggaa
ttagatttgaaaacagtagtgccttgctgtagtggacccaaaaggcctcaggacaaagtt
gctgtgtccgacatgaaaaaggactttgagagctgccttggagccaagcaaggatttaaa
ggattccaagttgctcctgaacatcataatgaccataagacctttatctatgataacact
gaattcacccttgctcatggttctgtggtcattgctgccattactagctgcacaaacacc
agtaatccgtctgtgatgttaggggcaggattgttagcaaagaaagctgtggatgctggc
ctgaacgtgatgccttacatcaaaactagcctgtctcctgggagtggcgtggtcacctac
tacctacaagaaagcggagtcatgccttatctgtctcagcttgggtttgacgtggtgggc
tatggctgcatgacctgcattggcaacagtgggcctttacctgaacctgtggtagaagcc
atcacacagggagaccttgtagctgttggagtactatctggaaacaggaattttgaaggt
cgagttcaccccaacacccgggccaactatttagcctctccccccttagtaatagcatat
gcaattgctggaaccatcagaatcgactttgagaaagagccattgggagtaaatgcaaag
ggacagcaggtatttctgaaagatatctggccgactagagacgagatccaggcagtggag
cgtcagtatgtcatcccggggatgtttaaggaagtctatcagaaaatagagactgtgaat
gaaagctggaatgccttagcaaccccatcagataagctgtttttctggaattccaaatct
acgtatatcaaatcaccaccattctttgaaaacctgactttggatcttcagccccctaaa
tctatagtggatgcctatgtgctgctaaatttgggagattcggtaacaactgaccacatc
tccccagctggaaatattgcaagaaacagtcctgctgctcgctacttaactaacagaggc
ctaactccacgagaattcaactcctatggctcccgccgaggtaatgacgccgtcatggca
cggggaacatttgccaacattcgcttgttaaacagatttttgaacaagcaggcaccacag
actatccatctgccttctggggaaatccttgatgtgtttgatgctgctgagcggtaccag
caggcaggccttcccctgatcgttctggctggcaaagagtacggtgcaggcagctcccga
gactgggcagctaagggccctttcctgctgggaatcaaagccgtcctggccgagagctac
gagcgcattcaccgcagtaacctggttgggatgggtgtgatcccacttgaatatctccct
ggtgagaatgcagatgccctggggctcacagggcaagaacgatacactatcattattcca
gaaaacctcaaaccacaaatgaaagtccaggtcaagctggatactggcaagaccttccag
gctgtcatgaggtttgacactgatgtggagctcacttatttcctcaacgggggcatcctc
aactacatgatccgcaagatggccaagtag

DBGET integrated database retrieval system