KEGG   Homo sapiens (human): 48Help
Entry
48                CDS       T01001                                 

Gene name
ACO1, ACONS, HEL60, IREB1, IREBP, IREBP1, IRP1
Definition
aconitase 1, soluble (EC:4.2.1.3)
Orthology
K01681  
aconitate hydratase [EC:4.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    48 (ACO1)
   01210 2-Oxocarboxylic acid metabolism
    48 (ACO1)
   01230 Biosynthesis of amino acids
    48 (ACO1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    48 (ACO1)
   00630 Glyoxylate and dicarboxylate metabolism
    48 (ACO1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     48 (ACO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p21.1
AA seq 889 aa AA seqDB search
MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDI
ENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTY
YLQESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMA
RGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSR
DWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacccattcgcacaccttgctgagccattggatcctgtacaaccaggaaagaaa
ttcttcaatttgaataaattggaggattcaagatatgggcgcttaccattttcgatcaga
gttcttctggaagcagccattcggaattgtgatgagtttttggtgaagaaacaggatatt
gaaaatattctacattggaatgtcacgcagcacaagaacatagaagtgccatttaagcct
gctcgtgtcatcctgcaggactttacgggtgtgcccgctgtggttgactttgctgcaatg
cgtgatgctgtgaaaaagttaggaggagatccagagaaaataaaccctgtctgccctgct
gatcttgtaatagatcattccatccaggttgatttcaacagaagggcagacagtttacag
aagaatcaagacctggaatttgaaagaaatagagagcgatttgaatttttaaagtggggt
tcccaggcttttcacaacatgcggattattccccctggctcaggaatcatccaccaggtg
aatttggaatatttggcaagagtggtatttgatcaggatggatattattacccagacagc
ctcgtgggcacagactcgcacactaccatgattgatggcttgggcattcttggttggggt
gtcggtggtattgaagcagaagctgtcatgctgggtcagccaatcagtatggtgcttcct
caggtgattggctacaggctgatggggaagccccaccctctggtaacatccactgacatc
gtgctcaccattaccaagcacctccgccaggttggggtagtgggcaaatttgtcgagttc
ttcgggcctggagtagcccagttgtccattgctgaccgagctacgattgctaacatgtgt
ccagagtacggagcaactgctgcctttttcccagttgatgaagttagtatcacgtacctg
gtgcaaacaggtcgtgatgaagaaaaattaaagtatattaaaaaatatcttcaggctgta
ggaatgtttcgagatttcaatgacccttctcaagacccagacttcacccaggttgtggaa
ttagatttgaaaacagtagtgccttgctgtagtggacccaaaaggcctcaggacaaagtt
gctgtgtccgacatgaaaaaggactttgagagctgccttggagccaagcaaggatttaaa
ggattccaagttgctcctgaacatcataatgaccataagacctttatctatgataacact
gaattcacccttgctcatggttctgtggtcattgctgccattactagctgcacaaacacc
agtaatccgtctgtgatgttaggggcaggattgttagcaaagaaagctgtggatgctggc
ctgaacgtgatgccttacatcaaaactagcctgtctcctgggagtggcgtggtcacctac
tacctacaagaaagcggagtcatgccttatctgtctcagcttgggtttgacgtggtgggc
tatggctgcatgacctgcattggcaacagtgggcctttacctgaacctgtggtagaagcc
atcacacagggagaccttgtagctgttggagtactatctggaaacaggaattttgaaggt
cgagttcaccccaacacccgggccaactatttagcctctccccccttagtaatagcatat
gcaattgctggaaccatcagaatcgactttgagaaagagccattgggagtaaatgcaaag
ggacagcaggtatttctgaaagatatctggccgactagagacgagatccaggcagtggag
cgtcagtatgtcatcccggggatgtttaaggaagtctatcagaaaatagagactgtgaat
gaaagctggaatgccttagcaaccccatcagataagctgtttttctggaattccaaatct
acgtatatcaaatcaccaccattctttgaaaacctgactttggatcttcagccccctaaa
tctatagtggatgcctatgtgctgctaaatttgggagattcggtaacaactgaccacatc
tccccagctggaaatattgcaagaaacagtcctgctgctcgctacttaactaacagaggc
ctaactccacgagaattcaactcctatggctcccgccgaggtaatgacgccgtcatggca
cggggaacatttgccaacattcgcttgttaaacagatttttgaacaagcaggcaccacag
actatccatctgccttctggggaaatccttgatgtgtttgatgctgctgagcggtaccag
caggcaggccttcccctgatcgttctggctggcaaagagtacggtgcaggcagctcccga
gactgggcagctaagggccctttcctgctgggaatcaaagccgtcctggccgagagctac
gagcgcattcaccgcagtaacctggttgggatgggtgtgatcccacttgaatatctccct
ggtgagaatgcagatgccctggggctcacagggcaagaacgatacactatcattattcca
gaaaacctcaaaccacaaatgaaagtccaggtcaagctggatactggcaagaccttccag
gctgtcatgaggtttgacactgatgtggagctcacttatttcctcaacgggggcatcctc
aactacatgatccgcaagatggccaagtag

DBGET integrated database retrieval system