KEGG   Homo sapiens (human): 4802Help
Entry
4802              CDS       T01001                                 

Gene name
NFYC, CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC
Definition
nuclear transcription factor Y, gamma
Orthology
K08066  
nuclear transcription factor Y, gamma
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Tuberculosis
Class
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32
AA seq 334 aa AA seqDB search
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQLYQI
QQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagaaggaggatttggtggtactagcagcagtgatgcccagcaaagcctacag
tcgttctggcctcgggtcatggaagaaatccggaatttaacagtgaaagacttccgagtg
caggaactcccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcgcctgtactctttgccaaggcagcccagatttttatcacagagttg
actcttcgagcctggattcacacagaagataacaagcgccggactctacagagaaatgat
atcgccatggcaattacaaaatttgatcagtttgattttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgtcaggaggaggtgcgccagtctgtaactcctgccgag
ccagtccagtactatttcacgctggctcagcaacccaccgctgtccaagtccagggccag
cagcaaggccagcagaccaccagctccacgaccaccatccagcctgggcagatcatcatc
gcacagcctcagcagggccagaccacacctgtgacaatgcaggttggagaaggtcagcag
gtgcagattgtccaggctcagccacagggtcaagcccaacaggcccagagtggcactgga
cagaccatgcaggtgatgcagcagatcatcactaacacaggagagatccagcagatcccg
gtgcagctgaatgccggccagctgcagtatatccgcttagcccagcctgtatcaggcact
caagttgtgcagggacagatccagacacttgccaccaatgctcaacagattacacagaca
gaggtccagcaaggacagcagcagttcagccagttcacagatggacagctctaccagatc
cagcaagtcaccatgcctgcgggccaggacctcgcccagcccatgttcatccagtcagcc
aaccagccctccgacgggcaggccccccaggtgaccggcgactga

DBGET integrated database retrieval system