KEGG   Homo sapiens (human): 4807Help
Entry
4807              CDS       T01001                                 

Gene name
NHLH1, HEN1, NSCL, NSCL1, bHLHa35
Definition
(RefSeq) nescient helix-loop-helix 1
  KO
K09075  
nescient helix-loop-helix protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, HEN
    4807 (NHLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q02575(Tbio)
UniProt: 
Position
1q23.2
AA seq 133 aa AA seqDB search
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcaactcagacaccatggagctggacctgccgcccacccactcagagactgag
tcgggcttcagtgactgtgggggcggggcgggccctgatggtgccgggcctgggggtccg
ggagggggccaggcccgaggcccagagccgggagagcctggccggaaagacctgcagcat
ctgagccgcgaggagcgccggcgccggcgccgcgccacagccaagtaccgcacggcccac
gccacgcgagaacgcatccgcgtggaagccttcaacctggccttcgccgagctgcgcaag
ctgctgcctacgctgccccccgacaagaagctctccaagattgagattctgcgcctggcc
atctgctatatctcctacctgaaccacgtgctggacgtctga

DBGET integrated database retrieval system