KEGG   Homo sapiens (human): 4809Help
Entry
4809              CDS       T01001                                 

Gene name
SNU13, 15.5K, FA-1, FA1, NHP2L1, NHPX, OTK27, SNRNP15-5, SPAG12, SSFA1
Definition
(RefSeq) small nuclear ribonucleoprotein 13
  KO
K12845  
U4/U6 small nuclear ribonucleoprotein SNU13
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    4809 (SNU13)
  Translation
   03008 Ribosome biogenesis in eukaryotes
    4809 (SNU13)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4809 (SNU13)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box C/D snoRNPs
    4809 (SNU13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P55769(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 128 aa AA seqDB search
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADA
EPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQ
QSIERLLV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggctgatgtgaatccaaaggcctatccccttgccgatgcccacctcaccaag
aagctactggacctcgttcagcagtcatgtaactataagcagcttcggaaaggagccaat
gaggccaccaaaaccctcaacaggggcatctctgagttcatcgtgatggctgcagacgcc
gagccactggagatcattctgcacctgccgctgctgtgtgaagacaagaatgtgccctac
gtgtttgtgcgctccaagcaggccctggggagagcctgtggggtctccaggcctgtcatc
gcctgttctgtcaccatcaaagaaggctcgcagctgaaacagcagatccaatccattcag
cagtccattgaaaggctcttagtctaa

DBGET integrated database retrieval system