KEGG   Homo sapiens (human): 4824Help
Entry
4824              CDS       T01001                                 

Gene name
NKX3-1, BAPX2, NKX3, NKX3.1, NKX3A
Definition
NK3 homeobox 1
Orthology
K09348  
homeobox protein Nkx-3.1
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Prostate cancer
Disease
H00024  
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4824 (NKX3-1)
   05215 Prostate cancer
    4824 (NKX3-1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    4824 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21.2
AA seq 159 aa AA seqDB search
MLRVPEPRPGEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQ
VIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHS
SLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgctcagggttccggagccgcggcccggggaggccgagacgctggcagagaccgagcca
gaaaggcacttggggtcttatctgttggactctgaaaacacttcaggcgcccttccaagg
cttccccaaacccctaagcagccgcagaagcgctcccgagctgccttctcccacactcag
gtgatcgagttggagaggaagttcagccatcagaagtacctgtcggcccctgaacgggcc
cacctggccaagaacctcaagctcacggagacccaagtgaagatatggttccagaacaga
cgctataagactaagcgaaagcagctctcctcggagctgggagacttggagaagcactcc
tctttgccggccctgaaagaggaggccttctcccgggcctccctggtctccgtgtataac
agctatccttactacccatacctgtactgcgtgggcagctggagcccagctttttggtaa

DBGET integrated database retrieval system