KEGG   Homo sapiens (human): 4825Help
Entry
4825              CDS       T01001                                 

Gene name
NKX6-1, NKX6.1, NKX6A
Definition
(RefSeq) NK6 homeobox 1
  KO
K08030  homeobox protein Nkx-6.1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    4825 (NKX6-1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    4825 (NKX6-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox
Motif
Other DBs
NCBI-GeneID: 4825
NCBI-ProteinID: NP_006159
OMIM: 602563
HGNC: 7839
Ensembl: ENSG00000163623
Vega: OTTHUMG00000130426
Pharos: P78426(Tbio)
UniProt: P78426
Position
4q21.23
AA seq 367 aa AA seqDB search
MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSP
SPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SGSSSSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPS
AAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTR
PTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMA
TAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGLLLHA
SEPESSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgttagcggtgggggcaatggagggcacccggcagagcgcattcctgctcagcagccct
cccctggccgccctgcacagcatggccgagatgaagaccccgctgtaccctgccgcgtat
cccccgctgcctgccggccccccctcctcctcgtcctcgtcgtcgtcctcctcgtcgccc
tccccgcctctgggcacccacaacccaggcggcctgaagcccccggccacgggggggctc
tcatccctcggcagccccccgcagcagctctcggccgccaccccacacggcatcaacgat
atcctgagccggccctccatgcccgtggcctcgggggccgccctgccctccgcctcgccc
tccggttcctcctcctcctcttcctcgtccgcctctgcctcctccgcctctgccgccgcc
gcggctgctgccgcggccgcagccgccgcctcatccccggcggggctgctggccggactg
ccacgctttagcagcctgagcccgccgccgccgccgcccgggctctacttcagccccagc
gccgcggccgtggccgccgtgggccggtaccccaagccgctggctgagctgcctggccgg
acgcccatcttctggcccggagtgatgcagagcccgccctggagggacgcacgcctggcc
tgtacccctcatcaaggatccattttgttggacaaagacgggaagagaaaacacacgaga
cccactttttccggacagcagatcttcgccctggagaagactttcgaacaaacaaaatac
ttggcggggcccgagagggctcgtttggcctattcgttggggatgacagagagtcaggtc
aaggtctggttccagaaccgccggaccaagtggaggaagaagcacgctgccgagatggcc
acggccaagaagaagcaggactcggagacagagcgcctcaagggggcctcggagaacgag
gaagaggacgacgactacaataagcctctggatcccaactcggacgacgagaaaatcacg
cagctgttgaagaagcacaagtccagcagcggcggcggcggcggcctcctactgcacgcg
tccgagccggagagctcatcctga

DBGET integrated database retrieval system