KEGG   Homo sapiens (human): 4837Help
Entry
4837              CDS       T01001                                 

Gene name
NNMT
Definition
nicotinamide N-methyltransferase (EC:2.1.1.1)
Orthology
K00541  
nicotinamide N-methyltransferase [EC:2.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4837 (NNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.1  nicotinamide N-methyltransferase
     4837 (NNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.1
AA seq 264 aa AA seqDB search
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaggcttcacctccaaggacacctatctaagccattttaaccctcgggattac
ctagaaaaatattacaagtttggttctaggcactctgcagaaagccagattcttaagcac
cttctgaaaaatcttttcaagatattctgcctagacggtgtgaagggagacctgctgatt
gacatcggctctggccccactatctatcagctcctctctgcttgtgaatcctttaaggag
atcgtcgtcactgactactcagaccagaacctgcaggagctggagaagtggctgaagaaa
gagccagaggcctttgactggtccccagtggtgacctatgtgtgtgatcttgaagggaac
agagtcaagggtccagagaaggaggagaagttgagacaggcggtcaagcaggtgctgaag
tgtgatgtgactcagagccagccactgggggccgtccccttacccccggctgactgcgtg
ctcagcacactgtgtctggatgccgcctgcccagacctccccacctactgcagggcgctc
aggaacctcggcagcctactgaagccagggggcttcctggtgatcatggatgcgctcaag
agcagctactacatgattggtgagcagaagttctccagcctccccctgggccgggaggca
gtagaggctgctgtgaaagaggctggctacacaatcgaatggtttgaggtgatctcgcaa
agttattcttccaccatggccaacaacgaaggacttttctccctggtggcgaggaagctg
agcagacccctgtga

DBGET integrated database retrieval system