KEGG   Homo sapiens (human): 4838Help
Entry
4838              CDS       T01001                                 

Gene name
NODAL, HTX5
Definition
(RefSeq) nodal growth differentiation factor
  KO
K04666  nodal
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00632  Heterotaxy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4838 (NODAL)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4838 (NODAL)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   4838 (NODAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 4838
NCBI-ProteinID: NP_060525
OMIM: 601265
HGNC: 7865
Ensembl: ENSG00000156574
Vega: OTTHUMG00000018408
Pharos: Q96S42(Tbio)
UniProt: Q96S42
Position
10q22.1
AA seq 347 aa AA seqDB search
MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRS
LQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPD
TEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGEC
WPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHL
PDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLL
KRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccactgcctgcccttccttctgcacgcctggtgggccctactccaggcgggt
gctgcgacggtggccactgcgctcctgcgtacgcgggggcagccctcgtcgccatcccct
ctggcgtacatgctgagcctctaccgcgacccgctgccgagggcagacatcatccgcagc
ctacaggcagaagatgtggcagtggatgggcagaactggacgtttgcttttgacttctcc
ttcctgagccaacaagaggatctggcatgggctgagctccggctgcagctgtccagccct
gtggacctccccactgagggctcacttgccattgagattttccaccagccaaagcccgac
acagagcaggcttcagacagctgcttagagcggtttcagatggacctattcactgtcact
ttgtcccaggtcaccttttccttgggcagcatggttttggaggtgaccaggcctctctcc
aagtggctgaagcaccctggggccctggagaagcagatgtccagggtagctggagagtgc
tggccgcggccccccacaccgcctgccaccaatgtgctccttatgctctactccaacctc
tcgcaggagcagaggcagctgggtgggtccaccttgctgtgggaagccgagagctcctgg
cgggcccaggagggacagctgtcctgggagtggggcaagaggcaccgtcgacatcacttg
ccagacagaagtcaactgtgtcggaaggtcaagttccaggtggacttcaacctgatcgga
tggggctcctggatcatctaccccaagcagtacaacgcctatcgctgtgagggcgagtgt
cctaatcctgttggggaggagtttcatccgaccaaccatgcatacatccagagtctgctg
aaacgttaccagccccaccgagtcccttccacttgttgtgccccagtgaagaccaagccg
ctgagcatgctgtatgtggataatggcagagtgctcctagatcaccataaagacatgatc
gtggaagaatgtgggtgcctctga

DBGET integrated database retrieval system