KEGG   Homo sapiens (human): 4838Help
Entry
4838              CDS       T01001                                 

Gene name
NODAL, HTX5
Definition
nodal growth differentiation factor
Orthology
K04666  
nodal
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Disease
H00632  
Heterotaxy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    4838 (NODAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
10q22.1
AA seq 347 aa AA seqDB search
MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRS
LQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPD
TEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGEC
WPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHL
PDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLL
KRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccactgcctgcccttccttctgcacgcctggtgggccctactccaggcgggt
gctgcgacggtggccactgcgctcctgcgtacgcgggggcagccctcgtcgccatcccct
ctggcgtacatgctgagcctctaccgcgacccgctgccgagggcagacatcatccgcagc
ctacaggcagaagatgtggcagtggatgggcagaactggacgtttgcttttgacttctcc
ttcctgagccaacaagaggatctggcatgggctgagctccggctgcagctgtccagccct
gtggacctccccactgagggctcacttgccattgagattttccaccagccaaagcccgac
acagagcaggcttcagacagctgcttagagcggtttcagatggacctattcactgtcact
ttgtcccaggtcaccttttccttgggcagcatggttttggaggtgaccaggcctctctcc
aagtggctgaagcaccctggggccctggagaagcagatgtccagggtagctggagagtgc
tggccgcggccccccacaccgcctgccaccaatgtgctccttatgctctactccaacctc
tcgcaggagcagaggcagctgggtgggtccaccttgctgtgggaagccgagagctcctgg
cgggcccaggagggacagctgtcctgggagtggggcaagaggcaccgtcgacatcacttg
ccagacagaagtcaactgtgtcggaaggtcaagttccaggtggacttcaacctgatcgga
tggggctcctggatcatctaccccaagcagtacaacgcctatcgctgtgagggcgagtgt
cctaatcctgttggggaggagtttcatccgaccaaccatgcatacatccagagtctgctg
aaacgttaccagccccaccgagtcccttccacttgttgtgccccagtgaagaccaagccg
ctgagcatgctgtatgtggataatggcagagtgctcctagatcaccataaagacatgatc
gtggaagaatgtgggtgcctctga

DBGET integrated database retrieval system