KEGG   Homo sapiens (human): 4848Help
Entry
4848              CDS       T01001                                 

Gene name
CNOT2, CDC36, HSPC131, NOT2, NOT2H
Definition
(RefSeq) CCR4-NOT transcription complex subunit 2
  KO
K12605  
CCR4-NOT transcription complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    4848 (CNOT2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4848 (CNOT2)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4848 (CNOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 540 aa AA seqDB search
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLA
SPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMS
LHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQ
PSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRRE
GSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGL
LTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSE
YLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWIT
RAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggactgatggacatacattatctgagaaaagaaactaccaggtgacaaacagc
atgtttggtgcttcaagaaagaagtttgtagagggggtcgacagtgactaccatgacgaa
aacatgtactacagccagtcttctatgtttccacatcggtcagaaaaagatatgctggca
tcaccatctacatcaggtcagctgtctcagtttggggcaagtttatacgggcaacaaagt
gcactaggccttccaatgagggggatgagcaacaatacccctcagttaaatcgcagctta
tcacaaggcactcagttaccgagccacgtcacgccaacaacaggggtaccaacaatgtca
cttcacacgcctccatctccaagcaggggtattttgcctatgaatcctaggaatatgatg
aaccactcccaggttggtcagggcattggaattcctagcaggacaaatagcatgagcagt
tcagggttaggtagccccaacagaagctcgccaagcataatatgtatgccaaagcagcag
ccttctcgacagccttttactgtgaacagtatgtctggatttggaatgaacaggaatcag
gcatttggaatgaataactccttatcaagtaacatttttaatggaacagacggaagtgaa
aatgtgacaggattggacctttcagatttcccagcattagcagaccgaaacaggagggaa
ggaagtggtaacccaactccattaataaaccccttggctggaagagctccttatgttgga
atggtaacaaaaccagcaaatgaacaatcccaggacttctcaatacacaatgaagatttt
ccagcattaccaggctccagctataaagatccaacatcaagtaatgatgacagtaaatct
aatttgaatacatctggcaagacaacttcaagtacagatggacccaaattccctggagat
aaaagttcaacaacacaaaataataaccagcagaaaaaagggatccaggtgttacctgat
ggtcgggttactaacattcctcaagggatggtgacggaccaatttggaatgattggcctg
ttaacatttatcagggcagcagagacagacccaggaatggtacatcttgcattaggaagt
gacttaacaacattaggcctcaatctgaactctcctgaaaatctctaccccaaatttgcg
tcaccctgggcatcttcaccttgtcgacctcaagacatagacttccatgttccatctgag
tacttaacgaacattcacattagggataagctggctgcaataaaacttggccgatatggt
gaagaccttctcttctatctctattacatgaatggaggagacgtattacaacttttagct
gcagtggagctttttaaccgtgattggagataccacaaagaagaacgagtatggattacc
agggcaccaggcatggagccaacaatgaaaaccaatacctatgagaggggaacatattac
ttctttgactgtcttaactggaggaaagtagctaaggagttccatctggaatatgacaaa
ttagaagaacggcctcacctgccatccaccttcaactacaaccctgctcagcaagccttc
taa

DBGET integrated database retrieval system