KEGG   Homo sapiens (human): 4852Help
Entry
4852              CDS       T01001                                 

Gene name
NPY, PYY4
Definition
(RefSeq) neuropeptide Y
  KO
K05232  
neuropeptide Y
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Adipocytokine signaling pathway
Regulation of lipolysis in adipocytes
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    4852 (NPY)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    4852 (NPY)
   04920 Adipocytokine signaling pathway
    4852 (NPY)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    4852 (NPY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P01303(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7p15.3
AA seq 97 aa AA seqDB search
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtaacaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg
tgcctgggtgcgctggccgaggcgtacccctccaagccggacaacccgggcgaggacgca
ccagcggaggacatggccagatactactcggcgctgcgacactacatcaacctcatcacc
aggcagagatatggaaaacgatccagcccagagacactgatttcagacctcttgatgaga
gaaagcacagaaaatgttcccagaactcggcttgaagaccctgcaatgtggtga

DBGET integrated database retrieval system