KEGG   Homo sapiens (human): 4853Help
Entry
4853              CDS       T01001                                 

Gene name
NOTCH2, AGS2, HJCYS, hN2
Definition
(RefSeq) notch 2
  KO
K20994  
Notch 2
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Dorso-ventral axis formation
Notch signaling pathway
Th1 and Th2 cell differentiation
Thyroid hormone signaling pathway
MicroRNAs in cancer
Breast cancer
Module
Notch signaling
Disease
H00409  
Type II diabetes mellitus
H00551  
Alagille syndrome
H00623  
Hajdu-Cheney syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    4853 (NOTCH2)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    4853 (NOTCH2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4853 (NOTCH2)
  Development
   04320 Dorso-ventral axis formation
    4853 (NOTCH2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4853 (NOTCH2)
   05224 Breast cancer
    4853 (NOTCH2)
  Drug resistance
   01522 Endocrine resistance
    4853 (NOTCH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13-p11
AA seq 2471 aa AA seqDB search
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctctgctgtgggcgctgctggcgctctggctgtgctgcgcg
gcccccgcgcatgcattgcagtgtcgagatggctatgaaccctgtgtaaatgaaggaatg
tgtgttacctaccacaatggcacaggatactgcaaatgtccagaaggcttcttgggggaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagccacgtgccgatgtgcctcagggtttacaggagaggac
tgccagtactcaacatctcatccatgctttgtgtctcgaccctgcctgaatggcggcaca
tgccatatgctcagccgggatacctatgagtgcacctgtcaagtcgggtttacaggtaag
gagtgccaatggacggatgcctgcctgtctcatccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcaaatgcctcacaggcttcacagggcagaaatgtgag
actgatgtcaatgagtgtgacattccaggacactgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggcttcacaggccagtactgtgacagc
ctgtatgtgccctgtgcaccctcaccttgtgtcaatggaggcacctgtcggcagactggt
gacttcacttttgagtgcaactgccttccaggttttgaagggagcacctgtgagaggaat
attgatgactgccctaaccacaggtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgtcccccacaatggacaggacagttctgcacagaggatgtggat
gaatgcctgctgcagcccaatgcctgtcaaaatgggggcacctgtgccaaccgcaatgga
ggctatggctgtgtatgtgtcaacggctggagtggagatgactgcagtgagaacattgat
gattgtgccttcgcctcctgtactccaggctccacctgcatcgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctaaatgggcaatatatt
tgcacctgcccacaaggctacaaaggggctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaacacggatggcgccttc
cactgtgagtgtctgaagggttatgcaggacctcgttgtgagatggacatcaatgagtgc
cattcagacccctgccagaatgatgctacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattagaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgtttccagtgcctgtgt
cctcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggtcagtgtcaggatggtattgattcctacacctgcatctgcaatcccgggtacatg
ggcgccatctgcagtgaccagattgatgaatgttacagcagcccttgcctgaacgatggt
cgctgcattgacctggtcaatggctaccagtgcaactgccagccaggcacgtcaggggtt
aattgtgaaattaattttgatgactgtgcaagtaacccttgtatccatggaatctgtatg
gatggcattaatcgctacagttgtgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaacggt
gtgaatggtttccgctgtatatgccccgagggaccccatcaccccagctgctactcacag
gtgaacgaatgcctgagcaatccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgtctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgcctttcgaatccatgccagaatggaggaacttgtgacaatctggtgaatggatacagg
tgtacttgcaagaagggctttaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagacagtattggctccctgttccccaaac
ccttgtgagaatgctgctgtttgcaaagagtcaccaaattttgagagttatacttgcttg
tgtgctcctggctggcaaggtcagcggtgtaccattgacattgacgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggcagctacatgtgtgaatgtcca
ccaggcttcagtggtatggactgtgaggaggacattgatgactgccttgccaatccttgc
cagaatggaggttcctgtatggatggagtgaatactttctcctgcctctgccttccgggt
ttcactggggataagtgccagacagacatgaatgagtgtctgagtgaaccctgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccattgtgagaacaacatcaatgagtgcactgagagctcctgtttcaatggtggc
acatgtgttgatgggattaactccttctcttgcttgtgccctgtgggtttcactggatcc
ttctgcctccatgagatcaatgaatgcagctctcatccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgcagctgccccctgggctacactgggaaaaactgt
cagaccctggtgaatctctgcagtcggtctccatgtaaaaacaaaggtacttgcgttcag
aaaaaagcagagtcccagtgcctatgtccatctggatgggctggtgcctattgtgacgtg
cccaatgtctcttgtgacatagcagcctccaggagaggtgtgcttgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgccccctgggc
tatactgggagctactgtgaggagcaactcgatgagtgtgcgtccaacccctgccagcac
ggggcaacatgcagtgacttcattggtggatacagatgcgagtgtgtcccaggctatcag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcttgcccaccaggcactcggggccta
ctctgtgaagagaacattgatgactgtgcccggggtccccattgccttaatggtggtcag
tgcatggataggattggaggctacagttgtcgctgcttgcctggctttgctggggagcgt
tgtgagggagacatcaacgagtgcctctccaacccctgcagctctgagggcagcctggac
tgtatacagctcaccaatgactacctgtgtgtttgccgtagtgcctttactggccggcac
tgtgaaaccttcgtcgatgtgtgtccccagatgccctgcctgaatggagggacttgtgct
gtggccagtaacatgcctgatggtttcatttgccgttgtcccccgggattttccggggca
aggtgccagagcagctgtggacaagtgaaatgtaggaagggggagcagtgtgtgcacacc
gcctctggaccccgctgcttctgccccagtccccgggactgcgagtcaggctgtgccagt
agcccctgccagcacgggggcagctgccaccctcagcgccagcctccttattactcctgc
cagtgtgccccaccattctcgggtagccgctgtgaactctacacggcaccccccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcgtctgtgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttctctcaccatggag
aacccctgggccaactgctcctccccacttccctgctgggattatatcaacaaccagtgt
gatgagctgtgcaacacggtcgagtgcctgtttgacaactttgaatgccaggggaacagc
aagacatgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
gggtgcaacagtgaggagtgtggttgggatgggctggactgtgctgctgaccaacctgag
aacctggcagaaggtaccctggttattgtggtattgatgccacctgaacaactgctccag
gatgctcgcagcttcttgcgggcactgggtaccctgctccacaccaacctgcgcattaag
cgggactcccagggggaactcatggtgtacccctattatggtgagaagtcagctgctatg
aagaaacagaggatgacacgcagatcccttcctggtgaacaagaacaggaggtggctggc
tctaaagtctttctggaaattgacaaccgccagtgtgttcaagactcagaccactgcttc
aagaacacggatgcagcagcagctctcctggcctctcacgccatacaggggaccctgtca
taccctcttgtgtctgtcgtcagtgaatccctgactccagaacgcactcagctcctctat
ctccttgctgttgctgttgtcatcattctgtttattattctgctgggggtaatcatggca
aaacgaaagcgtaagcatggctctctctggctgcctgaaggtttcactcttcgccgagat
gcaagcaatcacaagcgtcgtgagccagtgggacaggatgctgtggggctgaaaaatctc
tcagtgcaagtctcagaagctaacctaattggtactggaacaagtgaacactgggtcgat
gatgaagggccccagccaaagaaagtaaaggctgaagatgaggccttactctcagaagaa
gatgaccccattgatcgacggccatggacacagcagcaccttgaagctgcagacatccgt
aggacaccatcgctggctctcacccctcctcaggcagagcaggaggtggatgtgttagat
gtgaatgtccgtggcccagatggctgcaccccattgatgttggcttctctccgaggaggc
agctcagatttgagtgatgaagatgaagatgcagaggactcttctgctaacatcatcaca
gacttggtctaccagggtgccagcctccaggcccagacagaccggactggtgagatggcc
ctgcaccttgcagcccgctactcacgggctgatgctgccaagcgtctcctggatgcaggt
gcagatgccaatgcccaggacaacatgggccgctgtccactccatgctgcagtggcagct
gatgcccaaggtgtcttccagattctgattcgcaaccgagtaactgatctagatgccagg
atgaatgatggtactacacccctgatcctggctgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcggatgtgaatgcagtggatgaccatggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcaactcttttgttgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacacctctgtttcttgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgagacatcacagac
catatggatcgtcttccccgggatgtggctcgggatcgcatgcaccatgacattgtgcgc
cttctggatgaatacaatgtgaccccaagccctccaggcaccgtgttgacttctgctctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctgaagcacaccccaatgggc
aagaagtctagacggcccagtgccaagagtaccatgcctactagcctccctaaccttgcc
aaggaggcaaaggatgccaagggtagtaggaggaagaagtctctgagtgagaaggtccaa
ctgtctgagagttcagtaactttatcccctgttgattccctagaatctcctcacacgtat
gtttccgacaccacatcctctccaatgattacatcccctgggatcttacaggcctcaccc
aaccctatgttggccactgccgcccctcctgccccagtccatgcccagcatgcactatct
ttttctaaccttcatgaaatgcagcctttggcacatggggccagcactgtgcttccctca
gtgagccagttgctatcccaccaccacattgtgtctccaggcagtggcagtgctggaagc
ttgagtaggctccatccagtcccagtcccagcagattggatgaaccgcatggaggtgaat
gagacccagtacaatgagatgtttggtatggtcctggctccagctgagggcacccatcct
ggcatagctccccagagcaggccacctgaagggaagcacataaccacccctcgggagccc
ttgccccccattgtgactttccagctcatccctaaaggcagtattgcccaaccagcgggg
gctccccagcctcagtccacctgccctccagctgttgcgggccccctgcccaccatgtac
cagattccagaaatggcccgtttgcccagtgtggctttccccactgccatgatgccccag
caggacgggcaggtagctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggcaagtaccccacacccccttcacagcacagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggaggtcagcggggacctgggacacacatgtct
gagccaccacacaacaacatgcaggtttatgcgtga

DBGET integrated database retrieval system