KEGG   Homo sapiens (human): 4855Help
Entry
4855              CDS       T01001                                 

Gene name
NOTCH4, INT3
Definition
(RefSeq) notch 4
  KO
K02599  
Notch
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Dorso-ventral axis formation
Notch signaling pathway
Thyroid hormone signaling pathway
MicroRNAs in cancer
Breast cancer
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    4855 (NOTCH4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4855 (NOTCH4)
  Development
   04320 Dorso-ventral axis formation
    4855 (NOTCH4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4855 (NOTCH4)
   05224 Breast cancer
    4855 (NOTCH4)
  Drug resistance
   01522 Endocrine resistance
    4855 (NOTCH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 2003 aa AA seqDB search
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgctgctgctgctatgtgtctcagtg
gtcagacccagagggctgctgtgtgggagtttcccagaaccctgtgccaatggaggcacc
tgcctgagcctgtctctgggacaagggacctgccagtgtgcccctggcttcctgggtgag
acgtgccagtttcctgacccctgccagaacgcccagctctgccaaaatggaggcagctgc
caagccctgcttcccgctcccctagggctccccagctctccctctccattgacacccagc
ttcttgtgcacttgcctccctggcttcactggtgagagatgccaggccaagcttgaagac
ccttgtcctccctccttctgttccaaaaggggccgctgccacatccaggcctcgggccgc
ccacagtgctcctgcatgcctggatggacaggtgagcagtgccagcttcgggacttctgt
tcagccaacccatgtgttaatggaggggtgtgtctggccacatacccccagatccagtgc
cactgcccaccgggcttcgagggccatgcctgtgaacgtgatgtcaacgagtgcttccag
gacccaggaccctgccccaaaggcacctcctgccataacaccctgggctccttccagtgc
ctctgccctgtggggcaggagggtccacgttgtgagctgcgggcaggaccctgccctcct
aggggctgttcgaatgggggcacctgccagctgatgccagagaaagactccacctttcac
ctctgcctctgtcccccaggtttcataggcccagactgtgaggtgaatccagacaactgt
gtcagccaccagtgtcagaatgggggcacttgccaggatgggctggacacctacacctgc
ctctgcccagaaacctggacaggctgggactgctccgaagatgtggatgagtgtgagacc
cagggtccccctcactgcagaaacgggggcacctgccagaactctgctggtagctttcac
tgcgtgtgtgtgagtggctggggcggcacaagctgtgaggagaacctggatgactgtatt
gctgccacctgtgccccgggatccacctgcattgaccgggtgggctctttctcctgcctc
tgcccacctggacgcacaggactcctgtgccacttggaagacatgtgtctgagccagccg
tgccatggggatgcccaatgcagcaccaaccccctcacaggctccacactctgcctgtgt
cagcctggctattcggggcccacctgccaccaggacctggacgagtgtctgatggcccag
caaggcccaagtccctgtgaacatggcggttcctgcctcaacactcctggctccttcaac
tgcctctgtccacctggctacacaggctcccgttgtgaggctgatcacaatgagtgcctc
tcccagccctgccacccaggaagcacctgtctggacctacttgccaccttccactgcctc
tgcccgccaggcttagaagggcagctctgtgaggtggagaccaacgagtgtgcctcagct
ccctgcctgaaccacgcggattgccatgacctgctcaacggcttccagtgcatctgcctg
cctggattctccggcacccgatgtgaggaggatatcgatgagtgcagaagctctccctgt
gccaatggtgggcagtgccaggaccagcctggagccttccactgcaagtgtctcccaggc
tttgaagggccacgctgtcaaacagaggtggatgagtgcctgagtgacccatgtcccgtt
ggagccagctgccttgatcttccaggagccttcttttgcctctgcccctctggtttcaca
ggccagctctgtgaggttcccctgtgtgctcccaacctgtgccagcccaagcagatatgt
aaggaccagaaagacaaggccaactgcctctgtcctgatggaagccctggctgtgcccca
cctgaggacaactgcacctgccaccacgggcactgccagagatcctcatgtgtgtgtgac
gtgggttggacggggccagagtgtgaggcagagctagggggctgcatctctgcaccctgt
gcccatggggggacctgctacccccagccctctggctacaactgcacctgccctacaggc
tacacaggacccacctgtagtgaggagatgacagcttgtcactcagggccatgtctcaat
ggcggctcctgcaaccctagccctggaggctactactgcacctgccctccaagccacaca
gggccccagtgccaaaccagcactgactactgtgtgtctgccccgtgcttcaatgggggt
acctgtgtgaacaggcctggcaccttctcctgcctctgtgccatgggcttccagggcccg
cgctgtgagggaaagctccgccccagctgtgcagacagcccctgtaggaatagggcaacc
tgccaggacagccctcagggtccccgctgcctctgccccactggctacaccggaggcagc
tgccagactctgatggacttatgtgcccagaagccctgcccacgcaattcccactgcctc
cagactgggccctccttccactgcttgtgcctccagggatggaccgggcctctctgcaac
cttccactgtcctcctgccagaaggctgcactgagccaaggcatagacgtctcttccctt
tgccacaatggaggcctctgtgtcgacagcggcccctcctatttctgccactgcccccct
ggattccaaggcagcctgtgccaggatcacgtgaacccatgtgagtccaggccttgccag
aacggggccacctgcatggcccagcccagtgggtatctctgccagtgtgccccaggctac
gatggacagaactgctcaaaggaactcgatgcttgtcagtcccaaccctgtcacaaccat
ggaacctgtactcccaaacctggaggattccactgtgcctgccctccaggctttgtgggg
ctacgctgtgagggagacgtggacgagtgtctggaccagccctgccaccccacaggcact
gcagcctgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggc
cagtggtgtgaggtggagatagacccctgccacagccaaccctgctttcatggagggacc
tgtgaggccacagcaggatcacccctgggtttcatctgccactgccccaagggttttgaa
ggccccacctgcagccacagggccccttcctgcggcttccatcactgccaccacggaggc
ctgtgtctgccctcccctaagccaggcttcccaccacgctgtgcctgcctcagtggctat
gggggtcctgactgcctgaccccaccagctcctaaaggctgtggccctccctccccatgc
ctatacaatggcagctgctcagagaccacgggcttggggggcccaggctttcgatgctcc
tgccctcacagctctccagggccccggtgtcagaaacccggagccaaggggtgtgagggc
agaagtggagatggggcctgcgatgctggctgcagtggcccgggaggaaactgggatgga
ggggactgctctctgggagtcccagacccctggaagggctgcccctcccactctcggtgc
tggcttctcttccgggacgggcagtgccacccacagtgtgactctgaagagtgtctgttt
gatggctacgactgtgagacccctccagcctgcactccagcctatgaccagtactgccat
gatcacttccacaacgggcactgtgagaaaggctgcaacactgcagagtgtggctgggat
ggaggtgactgcaggcctgaagatggggacccagagtgggggccctccctggccctgctg
gtggtactgagccccccagccctagaccagcagctgtttgccctggcccgggtgctgtcc
ctgactctgagggtaggactctgggtaaggaaggatcgtgatggcagggacatggtgtac
ccctatcctggggcccgggctgaagaaaagctaggaggaactcgggaccccacctatcag
gagagagcagcccctcaaacgcagcccctgggcaaggagaccgactccctcagtgctggg
tttgtggtggtcatgggtgtggatttgtcccgctgtggccctgaccacccggcatcccgc
tgtccctgggaccctgggcttctactccgcttccttgctgcgatggctgcagtgggagcc
ctggagcccctgctgcctggaccactgctggctgtccaccctcatgcagggaccgcaccc
cctgccaaccagcttccctggcctgtgctgtgctccccagtggccggggtgattctcctg
gccctaggggctcttctcgtcctccagctcatccggcgtcgacgccgagagcatggagct
ctctggctgccccctggtttcactcgacggcctcggactcagtcagctccccaccgacgc
cggcccccactaggcgaggacagcattggtctcaaggcactgaagccaaaggcagaagtt
gatgaggatggagttgtgatgtgctcaggccctgaggagggagaggaggtgggccaggct
gaagaaacaggcccaccctccacgtgccagctctggtctctgagtggtggctgtggggcg
ctccctcaggcagccatgctaactcctccccaggaatctgagatggaagcccctgacctg
gacacccgtggacctgatggggtgacacccctgatgtcagcagtttgctgtggggaagta
cagtccgggaccttccaaggggcatggttgggatgtcctgagccctgggaacctctgctg
gatggaggggcctgtccccaggctcacaccgtgggcactggggagacccccctgcacctg
gctgcccgattctcccggccaaccgctgcccgccgcctccttgaggctggagccaacccc
aaccagccagaccgggcagggcgcacaccccttcatgctgctgtggctgctgatgctcgg
gaggtctgccagcttctgctccgtagcagacaaactgcagtggacgctcgcacagaggac
gggaccacacccttgatgctggctgccaggctggcggtggaagacctggttgaagaactg
attgcagcccaagcagacgtgggggccagagataaatgggggaaaactgcgctgcactgg
gctgctgccgtgaacaacgcccgagccgcccgctcgcttctccaggccggagccgataaa
gatgcccaggacaacagggagcagacgccgctattcctggcggcgcgggaaggagcggtg
gaagtagcccagctactgctggggctgggggcagcccgagagctgcgggaccaggctggg
ctagcgccggcggacgtcgctcaccaacgtaaccactgggatctgctgacgctgctggaa
ggggctgggccaccagaggcccgtcacaaagccacgccgggccgcgaggctgggcccttc
ccgcgcgcacggacggtgtcagtaagcgtgcccccgcatgggggcggggctctgccgcgc
tgccggacgctgtcagccggagcaggccctcgtgggggcggagcttgtctgcaggctcgg
acttggtccgtagacttggctgcgcgggggggcggggcctattctcattgccggagcctc
tcgggagtaggagcaggaggaggcccgacccctcgcggccgtaggttttctgcaggcatg
cgcgggcctcggcccaaccctgcgataatgcgaggaagatacggagtggctgccgggcgc
ggaggcagggtctcaacggatgactggccctgtgattgggtggccctgggagcttgcggt
tctgcctccaacattccgatcccgcctccttgccttactccgtccccggagcggggatca
cctcaacttgactgtggtcccccagccctccaagaaatgcccataaaccaaggaggagag
ggtaaaaaatag

DBGET integrated database retrieval system