KEGG   Homo sapiens (human): 4855Help
Entry
4855              CDS       T01001                                 

Gene name
NOTCH4, INT3
Definition
notch 4
Orthology
K02599  
Notch
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Notch signaling pathway
Thyroid hormone signaling pathway
MicroRNAs in cancer
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    4855 (NOTCH4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4855 (NOTCH4)
  Development
   04320 Dorso-ventral axis formation
    4855 (NOTCH4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    4855 (NOTCH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 2003 aa AA seqDB search
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgctgctgctgctatgtgtctcagtg
gtcagacccagagggctgctgtgtgggagtttcccagaaccctgtgccaatggaggcacc
tgcctgagcctgtctctgggacaagggacctgccagtgtgcccctggcttcctgggtgag
acgtgccagtttcctgacccctgccagaacgcccagctctgccaaaatggaggcagctgc
caagccctgcttcccgctcccctagggctccccagctctccctctccattgacacccagc
ttcttgtgcacttgcctccctggcttcactggtgagagatgccaggccaagcttgaagac
ccttgtcctccctccttctgttccaaaaggggccgctgccacatccaggcctcgggccgc
ccacagtgctcctgcatgcctggatggacaggtgagcagtgccagcttcgggacttctgt
tcagccaacccatgtgttaatggaggggtgtgtctggccacatacccccagatccagtgc
cactgcccaccgggcttcgagggccatgcctgtgaacgtgatgtcaacgagtgcttccag
gacccaggaccctgccccaaaggcacctcctgccataacaccctgggctccttccagtgc
ctctgccctgtggggcaggagggtccacgttgtgagctgcgggcaggaccctgccctcct
aggggctgttcgaatgggggcacctgccagctgatgccagagaaagactccacctttcac
ctctgcctctgtcccccaggtttcataggcccagactgtgaggtgaatccagacaactgt
gtcagccaccagtgtcagaatgggggcacttgccaggatgggctggacacctacacctgc
ctctgcccagaaacctggacaggctgggactgctccgaagatgtggatgagtgtgagacc
cagggtccccctcactgcagaaacgggggcacctgccagaactctgctggtagctttcac
tgcgtgtgtgtgagtggctggggcggcacaagctgtgaggagaacctggatgactgtatt
gctgccacctgtgccccgggatccacctgcattgaccgggtgggctctttctcctgcctc
tgcccacctggacgcacaggactcctgtgccacttggaagacatgtgtctgagccagccg
tgccatggggatgcccaatgcagcaccaaccccctcacaggctccacactctgcctgtgt
cagcctggctattcggggcccacctgccaccaggacctggacgagtgtctgatggcccag
caaggcccaagtccctgtgaacatggcggttcctgcctcaacactcctggctccttcaac
tgcctctgtccacctggctacacaggctcccgttgtgaggctgatcacaatgagtgcctc
tcccagccctgccacccaggaagcacctgtctggacctacttgccaccttccactgcctc
tgcccgccaggcttagaagggcagctctgtgaggtggagaccaacgagtgtgcctcagct
ccctgcctgaaccacgcggattgccatgacctgctcaacggcttccagtgcatctgcctg
cctggattctccggcacccgatgtgaggaggatatcgatgagtgcagaagctctccctgt
gccaatggtgggcagtgccaggaccagcctggagccttccactgcaagtgtctcccaggc
tttgaagggccacgctgtcaaacagaggtggatgagtgcctgagtgacccatgtcccgtt
ggagccagctgccttgatcttccaggagccttcttttgcctctgcccctctggtttcaca
ggccagctctgtgaggttcccctgtgtgctcccaacctgtgccagcccaagcagatatgt
aaggaccagaaagacaaggccaactgcctctgtcctgatggaagccctggctgtgcccca
cctgaggacaactgcacctgccaccacgggcactgccagagatcctcatgtgtgtgtgac
gtgggttggacggggccagagtgtgaggcagagctagggggctgcatctctgcaccctgt
gcccatggggggacctgctacccccagccctctggctacaactgcacctgccctacaggc
tacacaggacccacctgtagtgaggagatgacagcttgtcactcagggccatgtctcaat
ggcggctcctgcaaccctagccctggaggctactactgcacctgccctccaagccacaca
gggccccagtgccaaaccagcactgactactgtgtgtctgccccgtgcttcaatgggggt
acctgtgtgaacaggcctggcaccttctcctgcctctgtgccatgggcttccagggcccg
cgctgtgagggaaagctccgccccagctgtgcagacagcccctgtaggaatagggcaacc
tgccaggacagccctcagggtccccgctgcctctgccccactggctacaccggaggcagc
tgccagactctgatggacttatgtgcccagaagccctgcccacgcaattcccactgcctc
cagactgggccctccttccactgcttgtgcctccagggatggaccgggcctctctgcaac
cttccactgtcctcctgccagaaggctgcactgagccaaggcatagacgtctcttccctt
tgccacaatggaggcctctgtgtcgacagcggcccctcctatttctgccactgcccccct
ggattccaaggcagcctgtgccaggatcacgtgaacccatgtgagtccaggccttgccag
aacggggccacctgcatggcccagcccagtgggtatctctgccagtgtgccccaggctac
gatggacagaactgctcaaaggaactcgatgcttgtcagtcccaaccctgtcacaaccat
ggaacctgtactcccaaacctggaggattccactgtgcctgccctccaggctttgtgggg
ctacgctgtgagggagacgtggacgagtgtctggaccagccctgccaccccacaggcact
gcagcctgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggc
cagtggtgtgaggtggagatagacccctgccacagccaaccctgctttcatggagggacc
tgtgaggccacagcaggatcacccctgggtttcatctgccactgccccaagggttttgaa
ggccccacctgcagccacagggccccttcctgcggcttccatcactgccaccacggaggc
ctgtgtctgccctcccctaagccaggcttcccaccacgctgtgcctgcctcagtggctat
gggggtcctgactgcctgaccccaccagctcctaaaggctgtggccctccctccccatgc
ctatacaatggcagctgctcagagaccacgggcttggggggcccaggctttcgatgctcc
tgccctcacagctctccagggccccggtgtcagaaacccggagccaaggggtgtgagggc
agaagtggagatggggcctgcgatgctggctgcagtggcccgggaggaaactgggatgga
ggggactgctctctgggagtcccagacccctggaagggctgcccctcccactctcggtgc
tggcttctcttccgggacgggcagtgccacccacagtgtgactctgaagagtgtctgttt
gatggctacgactgtgagacccctccagcctgcactccagcctatgaccagtactgccat
gatcacttccacaacgggcactgtgagaaaggctgcaacactgcagagtgtggctgggat
ggaggtgactgcaggcctgaagatggggacccagagtgggggccctccctggccctgctg
gtggtactgagccccccagccctagaccagcagctgtttgccctggcccgggtgctgtcc
ctgactctgagggtaggactctgggtaaggaaggatcgtgatggcagggacatggtgtac
ccctatcctggggcccgggctgaagaaaagctaggaggaactcgggaccccacctatcag
gagagagcagcccctcaaacgcagcccctgggcaaggagaccgactccctcagtgctggg
tttgtggtggtcatgggtgtggatttgtcccgctgtggccctgaccacccggcatcccgc
tgtccctgggaccctgggcttctactccgcttccttgctgcgatggctgcagtgggagcc
ctggagcccctgctgcctggaccactgctggctgtccaccctcatgcagggaccgcaccc
cctgccaaccagcttccctggcctgtgctgtgctccccagtggccggggtgattctcctg
gccctaggggctcttctcgtcctccagctcatccggcgtcgacgccgagagcatggagct
ctctggctgccccctggtttcactcgacggcctcggactcagtcagctccccaccgacgc
cggcccccactaggcgaggacagcattggtctcaaggcactgaagccaaaggcagaagtt
gatgaggatggagttgtgatgtgctcaggccctgaggagggagaggaggtgggccaggct
gaagaaacaggcccaccctccacgtgccagctctggtctctgagtggtggctgtggggcg
ctccctcaggcagccatgctaactcctccccaggaatctgagatggaagcccctgacctg
gacacccgtggacctgatggggtgacacccctgatgtcagcagtttgctgtggggaagta
cagtccgggaccttccaaggggcatggttgggatgtcctgagccctgggaacctctgctg
gatggaggggcctgtccccaggctcacaccgtgggcactggggagacccccctgcacctg
gctgcccgattctcccggccaaccgctgcccgccgcctccttgaggctggagccaacccc
aaccagccagaccgggcagggcgcacaccccttcatgctgctgtggctgctgatgctcgg
gaggtctgccagcttctgctccgtagcagacaaactgcagtggacgctcgcacagaggac
gggaccacacccttgatgctggctgccaggctggcggtggaagacctggttgaagaactg
attgcagcccaagcagacgtgggggccagagataaatgggggaaaactgcgctgcactgg
gctgctgccgtgaacaacgcccgagccgcccgctcgcttctccaggccggagccgataaa
gatgcccaggacaacagggagcagacgccgctattcctggcggcgcgggaaggagcggtg
gaagtagcccagctactgctggggctgggggcagcccgagagctgcgggaccaggctggg
ctagcgccggcggacgtcgctcaccaacgtaaccactgggatctgctgacgctgctggaa
ggggctgggccaccagaggcccgtcacaaagccacgccgggccgcgaggctgggcccttc
ccgcgcgcacggacggtgtcagtaagcgtgcccccgcatgggggcggggctctgccgcgc
tgccggacgctgtcagccggagcaggccctcgtgggggcggagcttgtctgcaggctcgg
acttggtccgtagacttggctgcgcgggggggcggggcctattctcattgccggagcctc
tcgggagtaggagcaggaggaggcccgacccctcgcggccgtaggttttctgcaggcatg
cgcgggcctcggcccaaccctgcgataatgcgaggaagatacggagtggctgccgggcgc
ggaggcagggtctcaacggatgactggccctgtgattgggtggccctgggagcttgcggt
tctgcctccaacattccgatcccgcctccttgccttactccgtccccggagcggggatca
cctcaacttgactgtggtcccccagccctccaagaaatgcccataaaccaaggaggagag
ggtaaaaaatag

DBGET integrated database retrieval system