KEGG   Homo sapiens (human): 4860Help
Entry
4860              CDS       T01001                                 

Gene name
PNP, NP, PRO1837, PUNP
Definition
purine nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03783  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Disease
H00093  
Combined immunodeficiencies (CIDs)
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4860 (PNP)
   00240 Pyrimidine metabolism
    4860 (PNP)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4860 (PNP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     4860 (PNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q13.1
AA seq 289 aa AA seqDB search
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggatacacctatgaagattataagaacactgcagaatggcttctgtctcac
actaagcaccgacctcaagttgcaataatctgtggttctggattaggaggtctgactgat
aaattaactcaggcccagatctttgactacggtgaaatccccaactttccccgaagtaca
gtgccaggtcatgctggccgactggtgtttgggttcctgaatggcagggcctgtgtgatg
atgcagggcaggttccacatgtatgaagggtacccactctggaaggtgacattcccagtg
agggttttccaccttctgggtgtggacaccctggtagtcaccaatgcagcaggagggctg
aaccccaagtttgaggttggagatatcatgctgatccgtgaccatatcaacctacctggt
ttcagtggtcagaaccctctcagagggcccaatgatgaaaggtttggagatcgtttccct
gccatgtctgatgcctacgaccggactatgaggcagagggctctcagtacctggaaacaa
atgggggagcaacgtgagctacaggaaggcacctatgtgatggtggcaggccccagcttt
gagactgtggcagaatgtcgtgtgctgcagaagctgggagcagacgctgttggcatgagt
acagtaccagaagttatcgttgcacggcactgtggacttcgagtctttggcttctcactc
atcactaacaaggtcatcatggattatgaaagcctggagaaggccaaccatgaagaagtc
ttagcagctggcaaacaagctgcacagaaattggaacagtttgtctccattcttatggcc
agcattccactccctgacaaagccagttga

DBGET integrated database retrieval system