KEGG   Homo sapiens (human): 4869Help
Entry
4869              CDS       T01001                                 

Gene name
NPM1, B23, NPM
Definition
nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Orthology
K11276  
nucleophosmin 1
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.1
AA seq 259 aa AA seqDB search
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKAH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaagattcgatggacatggacatgagccccctgaggccccagaactatcttttcggt
tgtgaactaaaggccgacaaagattatcactttaaggtggataatgatgaaaatgagcac
cagttatctttaagaacggtcagtttaggggctggtgcaaaggatgagttgcacattgtt
gaagcagaggcaatgaattacgaaggcagtccaattaaagtaacactggcaactttgaaa
atgtctgtacagccaacggtttcccttgggggctttgaaataacaccaccagtggtctta
aggttgaagtgtggttcagggccagtgcatattagtggacagcacttagtagctgtggag
gaagatgcagagtcagaagatgaagaggaggaggatgtgaaactcttaagtatatctgga
aagcggtctgcccctggaggtggtagcaaggttccacagaaaaaagtaaaacttgctgct
gatgaagatgatgacgatgatgatgaagaggatgatgatgaagatgatgatgatgatgat
tttgatgatgaggaagctgaagaaaaagcgccagtgaagaaatctatacgagatactcca
gccaaaaatgcacaaaagtcaaatcagaatggaaaagactcaaaaccatcatcaacacca
agatcaaaaggacaagaatccttcaagaaacaggaaaaaactcctaaaacaccaaaagga
cctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaagcgcattga

DBGET integrated database retrieval system