KEGG   Homo sapiens (human): 4869Help
Entry
4869              CDS       T01001                                 

Gene name
NPM1, B23, NPM
Definition
(RefSeq) nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  KO
K11276  
nucleophosmin 1
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     4869 (NPM1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     4869 (NPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.1
AA seq 259 aa AA seqDB search
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKAH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaagattcgatggacatggacatgagccccctgaggccccagaactatcttttcggt
tgtgaactaaaggccgacaaagattatcactttaaggtggataatgatgaaaatgagcac
cagttatctttaagaacggtcagtttaggggctggtgcaaaggatgagttgcacattgtt
gaagcagaggcaatgaattacgaaggcagtccaattaaagtaacactggcaactttgaaa
atgtctgtacagccaacggtttcccttgggggctttgaaataacaccaccagtggtctta
aggttgaagtgtggttcagggccagtgcatattagtggacagcacttagtagctgtggag
gaagatgcagagtcagaagatgaagaggaggaggatgtgaaactcttaagtatatctgga
aagcggtctgcccctggaggtggtagcaaggttccacagaaaaaagtaaaacttgctgct
gatgaagatgatgacgatgatgatgaagaggatgatgatgaagatgatgatgatgatgat
tttgatgatgaggaagctgaagaaaaagcgccagtgaagaaatctatacgagatactcca
gccaaaaatgcacaaaagtcaaatcagaatggaaaagactcaaaaccatcatcaacacca
agatcaaaaggacaagaatccttcaagaaacaggaaaaaactcctaaaacaccaaaagga
cctagttctgtagaagacattaaagcaaaaatgcaagcaagtatagaaaaagcgcattga

DBGET integrated database retrieval system