KEGG   Homo sapiens (human): 4881Help
Entry
4881              CDS       T01001                                 

Gene name
NPR1, ANPRA, ANPa, GUC2A, GUCY2A, NPRA
Definition
natriuretic peptide receptor 1 (EC:4.6.1.2)
Orthology
K12323  
atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Oxytocin signaling pathway
Drug target
Nesiritide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4881 (NPR1)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    4881 (NPR1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    4881 (NPR1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4881 (NPR1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4881 (NPR1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: RGC group
  RGC family [OT]
   4881 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21-q22
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgctggctcccgcctgcgcctgctcctgctcctgctgctg
ccgccgctgctgctgctgctccggggcagccacgcgggcaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccctggtcgtgggcgcgcgtgggacccgccgtggag
ctggccctggcccaggtgaaggcgcgccccgacttgctgccgggctggacggtccgcacg
gtgctgggcagcagcgaaaacgcgctgggcgtctgctccgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaaccccgctgtgttcctgggccccggctgcgtgtac
gccgccgccccagtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtatgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcctaccggccgggtgacgaagagcactgcttcttcctcgtg
gaggggctgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgatgccttcagaaccctcatgctcctggccctggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttgggcaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatgggcaggatgtc
agtgcccgccaggcctttcaggctgccaaaatcattacatataaagacccagataatccc
gagtacttggaattcctgaagcagttaaaacacctggcctatgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgacgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgttactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagaatggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttccaccctggaggtgctggctttggtgggcagc
ctctccttgctcggcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcaggcagccggctgaccctgagcgggagaggctccaattac
ggctccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctggactggatgttccggtactcactcacc
aatgacatcgtcaagggcatgctgtttctacacaatggggctatctgttcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagggacctggacccagagcaaggacacaccgtttatgccaaaaagctg
tggacggcccctgagctcctgcgaatggcttcaccccctgtgcggggctcccaggctggt
gacgtatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccac
gtggaaggtttggacctgagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttggggctgctcatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaaatttaacagggagaacagcagcaacatcctggacaacctgctgtcccgcatg
gagcagtacgcgaacaatctggaggaactggtggaggagcggacccaggcatacctggag
gagaagcgcaaggctgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagacggtgcaggccgaagcctttgacagtgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcggcggagagcacacccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagacaactttgatgtgtacaaggtg
gagacaattggcgatgcctacatggtggtgtcagggctccctgtgcggaacgggcggcta
cacgcctgcgaggtagcccgcatggccctggcactgctggatgctgtgcgctccttccga
atccgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacctgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggggatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctccttggggagagggggagtagcacccga
ggctga

DBGET integrated database retrieval system