KEGG   Homo sapiens (human): 4881Help
Entry
4881              CDS       T01001                                 

Gene name
NPR1, ANPRA, ANPa, GUC2A, GUCY2A, NPRA
Definition
(RefSeq) natriuretic peptide receptor 1 (EC:4.6.1.2)
  KO
K12323  
atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
cAMP signaling pathway
Vascular smooth muscle contraction
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Module
cGMP signaling
Drug target
Nesiritide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4881 (NPR1)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    4881 (NPR1)
   04022 cGMP - PKG signaling pathway
    4881 (NPR1)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    4881 (NPR1)
   04921 Oxytocin signaling pathway
    4881 (NPR1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4881 (NPR1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4881 (NPR1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: RGC group
  RGC family [OT]
   4881 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21-q22
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgctggctcccgcctgcgcctgctcctgctcctgctgctg
ccgccgctgctgctgctgctccggggcagccacgcgggcaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccctggtcgtgggcgcgcgtgggacccgccgtggag
ctggccctggcccaggtgaaggcgcgccccgacttgctgccgggctggacggtccgcacg
gtgctgggcagcagcgaaaacgcgctgggcgtctgctccgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaaccccgctgtgttcctgggccccggctgcgtgtac
gccgccgccccagtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtatgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcctaccggccgggtgacgaagagcactgcttcttcctcgtg
gaggggctgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgatgccttcagaaccctcatgctcctggccctggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttgggcaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatgggcaggatgtc
agtgcccgccaggcctttcaggctgccaaaatcattacatataaagacccagataatccc
gagtacttggaattcctgaagcagttaaaacacctggcctatgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgacgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgttactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagaatggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttccaccctggaggtgctggctttggtgggcagc
ctctccttgctcggcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcaggcagccggctgaccctgagcgggagaggctccaattac
ggctccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctggactggatgttccggtactcactcacc
aatgacatcgtcaagggcatgctgtttctacacaatggggctatctgttcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagggacctggacccagagcaaggacacaccgtttatgccaaaaagctg
tggacggcccctgagctcctgcgaatggcttcaccccctgtgcggggctcccaggctggt
gacgtatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccac
gtggaaggtttggacctgagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttggggctgctcatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaaatttaacagggagaacagcagcaacatcctggacaacctgctgtcccgcatg
gagcagtacgcgaacaatctggaggaactggtggaggagcggacccaggcatacctggag
gagaagcgcaaggctgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagacggtgcaggccgaagcctttgacagtgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcggcggagagcacacccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagacaactttgatgtgtacaaggtg
gagacaattggcgatgcctacatggtggtgtcagggctccctgtgcggaacgggcggcta
cacgcctgcgaggtagcccgcatggccctggcactgctggatgctgtgcgctccttccga
atccgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacctgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggggatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctccttggggagagggggagtagcacccga
ggctga

DBGET integrated database retrieval system