KEGG   Homo sapiens (human): 4886Help
Entry
4886              CDS       T01001                                 

Gene name
NPY1R, NPY1-R, NPYR
Definition
(RefSeq) neuropeptide Y receptor Y1
  KO
K04204  
neuropeptide Y receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    4886 (NPY1R)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4886 (NPY1R)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    4886 (NPY1R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    4886 (NPY1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q32.2
AA seq 384 aa AA seqDB search
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacattattttcccaggttgaaaatcattcagtccactctaatttctcagag
aagaatgcccagcttctggcttttgaaaatgatgattgtcatctgcccttggccatgata
tttaccttagctcttgcttatggagctgtgatcattcttggtgtctctggaaacctggcc
ttgatcataatcatcttgaaacaaaaggagatgagaaatgttaccaacatcctgattgtg
aacctttccttctcagacttgcttgttgccatcatgtgtctcccctttacatttgtctac
acattaatggaccactgggtctttggtgaggcgatgtgtaagttgaatccttttgtgcaa
tgtgtttcaatcactgtgtccattttctctctggttctcattgctgtggaacgacatcag
ctgataatcaaccctcgagggtggagaccaaataatagacatgcttatgtaggtattgct
gtgatttgggtccttgctgtggcttcttctttgcctttcctgatctaccaagtaatgact
gatgagccgttccaaaatgtaacacttgatgcgtacaaagacaaatacgtgtgctttgat
caatttccatcggactctcataggttgtcttataccactctcctcttggtgctgcagtat
tttggtccactttgttttatatttatttgctacttcaagatatatatacgcctaaaaagg
agaaacaacatgatggacaagatgagagacaataagtacaggtccagtgaaaccaaaaga
atcaatatcatgctgctctccattgtggtagcatttgcagtctgctggctccctcttacc
atctttaacactgtgtttgattggaatcatcagatcattgctacctgcaaccacaatctg
ttattcctgctctgccacctcacagcaatgatatccacttgtgtcaaccccatattttat
gggttcctgaacaaaaacttccagagagacttgcagttcttcttcaacttttgtgatttc
cggtctcgggatgatgattatgaaacaatagccatgtccacgatgcacacagatgtttcc
aaaacttctttgaagcaagcaagcccagtcgcatttaaaaaaatcaacaacaatgatgat
aatgaaaaaatctga

DBGET integrated database retrieval system