KEGG   Homo sapiens (human): 4887Help
Entry
4887              CDS       T01001                                 

Gene name
NPY2R, NPY2-R
Definition
neuropeptide Y receptor Y2
Orthology
K04205  
neuropeptide Y receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4887 (NPY2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    4887 (NPY2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31
AA seq 381 aa AA seqDB search
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaataggtgcagaggctgatgagaaccagacagtggaagaaatgaaggtggaa
caatacgggccacaaacaactcctagaggtgaactggtccctgaccctgagccagagctt
atagatagtaccaagctgattgaggtacaagttgttctcatattggcctactgctccatc
atcttgcttggggtaattggcaactccttggtgatccatgtggtgatcaaattcaagagc
atgcgcacagtaaccaactttttcattgccaatctggctgtggcagatcttttggtgaac
actctgtgtctaccgttcactcttacctataccttaatgggggagtggaaaatgggtcct
gtcctgtgccacctggtgccctatgcccagggcctggcagtacaagtatccacaatcacc
ttgacagtaattgccctggaccggcacaggtgcatcgtctaccacctagagagcaagatc
tccaagcgaatcagcttcctgattattggcttggcctggggcatcagtgccctgctggca
agtcccctggccatcttccgggagtattcgctgattgagatcattccggactttgagatt
gtggcctgtactgaaaagtggcctggcgaggagaagagcatctatggcactgtctatagt
ctttcttccttgttgatcttgtatgttttgcctctgggcattatatcattttcctacact
cgcatttggagtaaattgaagaaccatgtcagtcctggagctgcaaatgaccactaccat
cagcgaaggcaaaaaaccaccaaaatgctggtgtgtgtggtggtggtgtttgcggtcagc
tggctgcctctccatgccttccagcttgccgttgacattgacagccaggtcctggacctg
aaggagtacaaactcatcttcacagtgttccacattatcgccatgtgctccacttttgcc
aatccccttctctatggctggatgaacagcaactacagaaaggctttcctctcggccttc
cgctgtgagcagcggttggatgccattcactctgaggtgtccgtgacattcaaggctaaa
aagaacctggaggtcagaaagaacagtggccccaatgactctttcacagaggctaccaat
gtctaa

DBGET integrated database retrieval system