KEGG   Homo sapiens (human): 4889Help
Entry
4889              CDS       T01001                                 

Gene name
NPY5R, NPY5-R, NPYR5, NPYY5-R
Definition
(RefSeq) neuropeptide Y receptor Y5
  KO
K04207  
neuropeptide Y receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4889 (NPY5R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    4889 (NPY5R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q32.2
AA seq 445 aa AA seqDB search
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatttagagctcgacgagtattataacaagacacttgccacagagaataatactgct
gccactcggaattctgatttcccagtctgggatgactataaaagcagtgtagatgactta
cagtattttctgattgggctctatacatttgtaagtcttcttggctttatggggaatcta
cttattttaatggctctcatgaaaaagcgtaatcagaagactacggtaaacttcctcata
ggcaatctggccttttctgatatcttggttgtgctgttttgctcacctttcacactgacg
tctgtcttgctggatcagtggatgtttggcaaagtcatgtgccatattatgccttttctt
caatgtgtgtcagttttggtttcaactttaattttaatatcaattgccattgtcaggtat
catatgataaaacatcccatatctaataatttaacagcaaaccatggctactttctgata
gctactgtctggacactaggttttgccatctgttctccccttccagtgtttcacagtctt
gtggaacttcaagaaacatttggttcagcattgctgagcagcaggtatttatgtgttgag
tcatggccatctgattcatacagaattgcctttactatctctttattgctagttcagtat
attctgcccttagtttgtcttactgtaagtcatacaagtgtctgcagaagtataagctgt
ggattgtccaacaaagaaaacagacttgaagaaaatgagatgatcaacttaactcttcat
ccatccaaaaagagtgggcctcaggtgaaactctctggcagccataaatggagttattca
ttcatcaaaaaacacagaagaagatatagcaagaagacagcatgtgtgttacctgctcca
gaaagaccttctcaagagaaccactccagaatacttccagaaaactttggctctgtaaga
agtcagctctcttcatccagtaagttcataccaggggtccccacttgctttgagataaaa
cctgaagaaaattcagatgttcatgaattgagagtaaaacgttctgttacaagaataaaa
aagagatctcgaagtgttttctacagactgaccatactgatattagtatttgctgttagt
tggatgccactacaccttttccatgtggtaactgattttaatgacaatcttatttcaaat
aggcatttcaagttggtgtattgcatttgtcatttgttgggcatgatgtcctgttgtctt
aatccaattctatatgggtttcttaataatgggattaaagctgatttagtgtcccttata
cactgtcttcatatgtaa

DBGET integrated database retrieval system