KEGG   Homo sapiens (human): 49Help
Entry
49                CDS       T01001                                 

Gene name
ACR
Definition
acrosin (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     49 (ACR)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   49 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.33
AA seq 421 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPRPSSILMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQGDS
GGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALRMIQSA
TPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPPPPPASP
LPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKNHYDMETTELPELTST
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgtggttgctaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcaaaacccacagggtggt
gtccgcatcgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacgtacaacagccacaggtaccacacatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcgtcggcaaaaataatgtgcatgactggaga
ctggttttcggagcaaaggaaattacatatgggaacaataaaccagtaaaggcgcctctg
caagagagatatgtggagaaaatcatcattcatgaaaaatacaactctgcgacagaggga
aatgacattgccctcgtggagatcacccctcccatttcgtgtgggcgcttcattgggccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggcc
ggctggggatatatagaagagaaagcccccaggccatcatctatactgatggaggcacgt
gtggatctcatcgacctggacttgtgtaactcgacccagtggtacaatgggcgcgttcag
ccaaccaatgtgtgcgcggggtatcctgtaggcaagatcgacacctgccagggagacagc
ggcgggcctctcatgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcaca
agctggggggtaggctgtgcccgtgccaagcgccccggaatctacacggccacctggccc
tatctgaactggatcgcctccaagattggttctaacgctttgcgtatgattcaatcggcc
acccctccacctcccaccactcgaccgcccccgattcgaccccccttctcccaccctatc
tctgctcaccttccttggtatttccaaccgccccctcgaccacttccaccccgaccaccg
gcagcccagccccgacccccaccttcacccccgcccccacccccacctccagcctcacct
ttacccccacccccacccccacccccacctacaccctcatctaccacaaaacttccccaa
ggactttcttttgccaagcgcctacagcagctcatagaggtcttgaaggggaagacctat
tccgacggaaagaaccattatgacatggagaccacagagctcccagaactgacctcgacc
tcctga

DBGET integrated database retrieval system