KEGG   Homo sapiens (human): 4907Help
Entry
4907              CDS       T01001                                 

Gene name
NT5E, CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
Definition
(RefSeq) 5'-nucleotidase ecto (EC:3.1.3.5)
  KO
K19970  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Disease
H00824  
Calcification of joints and arteries
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4907 (NT5E)
   00240 Pyrimidine metabolism
    4907 (NT5E)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4907 (NT5E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4907 (NT5E)
Cellular antigens [BR:hsa04090]
 Proteins
  4907 (NT5E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  4907 (NT5E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q14-q21
AA seq 574 aa AA seqDB search
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccccgagccgcgcgggcgcccgcgacgctactcctcgccctgggcgcggtgctg
tggcctgcggctggcgcctgggagcttacgattttgcacaccaacgacgtgcacagccgg
ctggagcagaccagcgaggactccagcaagtgcgtcaacgccagccgctgcatgggtggc
gtggctcggctcttcaccaaggttcagcagatccgccgcgccgaacccaacgtgctgctg
ctggacgccggcgaccagtaccagggcactatctggttcaccgtgtacaagggcgccgag
gtggcgcacttcatgaacgccctgcgctacgatgccatggcactgggaaatcatgaattt
gataatggtgtggaaggactgatcgagccactcctcaaagaggccaaatttccaattctg
agtgcaaacattaaagcaaaggggccactagcatctcaaatatcaggactttatttgcca
tataaagttcttcctgttggtgatgaagttgtgggaatcgttggatacacttccaaagaa
accccttttctctcaaatccagggacaaatttagtgtttgaagatgaaatcactgcatta
caacctgaagtagataagttaaaaactctaaatgtgaacaaaattattgcactgggacat
tcgggttttgaaatggataaactcatcgctcagaaagtgaggggtgtggacgtcgtggtg
ggaggacactccaacacatttctttacacaggcaatccaccttccaaagaggtgcctgct
gggaagtacccattcatagtcacttctgatgatgggcggaaggttcctgtagtccaggcc
tatgcttttggcaaatacctaggctatctgaagatcgagtttgatgaaagaggaaacgtc
atctcttcccatggaaatcccattcttctaaacagcagcattcctgaagatccaagcata
aaagcagacattaacaaatggaggataaaattggataattattctacccaggaattaggg
aaaacaattgtctatctggatggctcctctcaatcatgccgctttagagaatgcaacatg
ggcaacctgatttgtgatgcaatgattaacaacaacctgagacacacggatgaaatgttc
tggaaccacgtatccatgtgcattttaaatggaggtggtatccggtcgcccattgatgaa
cgcaacaatggcacaattacctgggagaacctggctgctgtattgccctttggaggcaca
tttgacctagtccagttaaaaggttccaccctgaagaaggcctttgagcatagcgtgcac
cgctacggccagtccactggagagttcctgcaggtgggcggaatccatgtggtgtatgat
ctttcccgaaaacctggagacagagtagtcaaattagatgttctttgcaccaagtgtcga
gtgcccagttatgaccctctcaaaatggacgaggtatataaggtgatcctcccaaacttc
ctggccaatggtggagatgggttccagatgataaaagatgaattattaagacatgactct
ggtgaccaagatatcaacgtggtttctacatatatctccaaaatgaaagtaatttatcca
gcagttgaaggtcggatcaagttttccacaggaagtcactgccatggaagcttttcttta
atatttctttcactttgggcagtgatctttgttttataccaatag

DBGET integrated database retrieval system