KEGG   Homo sapiens (human): 4907Help
Entry
4907              CDS       T01001                                 

Gene name
NT5E, CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
Definition
5'-nucleotidase, ecto (CD73) (EC:3.1.3.5)
Orthology
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Disease
H00824  
Calcification of joints and arteries
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q14-q21
AA seq 524 aa AA seqDB search
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGIHVVYDLSRKPGDRVV
KLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVST
YISKMKVIYPAVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccccgagccgcgcgggcgcccgcgacgctactcctcgccctgggcgcggtgctg
tggcctgcggctggcgcctgggagcttacgattttgcacaccaacgacgtgcacagccgg
ctggagcagaccagcgaggactccagcaagtgcgtcaacgccagccgctgcatgggtggc
gtggctcggctcttcaccaaggttcagcagatccgccgcgccgaacccaacgtgctgctg
ctggacgccggcgaccagtaccagggcactatctggttcaccgtgtacaagggcgccgag
gtggcgcacttcatgaacgccctgcgctacgatgccatggcactgggaaatcatgaattt
gataatggtgtggaaggactgatcgagccactcctcaaagaggccaaatttccaattctg
agtgcaaacattaaagcaaaggggccactagcatctcaaatatcaggactttatttgcca
tataaagttcttcctgttggtgatgaagttgtgggaatcgttggatacacttccaaagaa
accccttttctctcaaatccagggacaaatttagtgtttgaagatgaaatcactgcatta
caacctgaagtagataagttaaaaactctaaatgtgaacaaaattattgcactgggacat
tcgggttttgaaatggataaactcatcgctcagaaagtgaggggtgtggacgtcgtggtg
ggaggacactccaacacatttctttacacaggcaatccaccttccaaagaggtgcctgct
gggaagtacccattcatagtcacttctgatgatgggcggaaggttcctgtagtccaggcc
tatgcttttggcaaatacctaggctatctgaagatcgagtttgatgaaagaggaaacgtc
atctcttcccatggaaatcccattcttctaaacagcagcattcctgaagatccaagcata
aaagcagacattaacaaatggaggataaaattggataattattctacccaggaattaggg
aaaacaattgtctatctggatggctcctctcaatcatgccgctttagagaatgcaacatg
ggcaacctgatttgtgatgcaatgattaacaacaacctgagacacacggatgaaatgttc
tggaaccacgtatccatgtgcattttaaatggaggtggtatccggtcgcccattgatgaa
cgcaacaatggaatccatgtggtgtatgatctttcccgaaaacctggagacagagtagtc
aaattagatgttctttgcaccaagtgtcgagtgcccagttatgaccctctcaaaatggac
gaggtatataaggtgatcctcccaaacttcctggccaatggtggagatgggttccagatg
ataaaagatgaattattaagacatgactctggtgaccaagatatcaacgtggtttctaca
tatatctccaaaatgaaagtaatttatccagcagttgaaggtcggatcaagttttccaca
ggaagtcactgccatggaagcttttctttaatatttctttcactttgggcagtgatcttt
gttttataccaatag

DBGET integrated database retrieval system