KEGG   Homo sapiens (human): 4908Help
Entry
4908              CDS       T01001                                 

Gene name
NTF3, HDNF, NGF-2, NGF2, NT-3, NT3
Definition
neurotrophin 3
Orthology
K04356  
neurotrophin 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 270 aa AA seqDB search
MVTFATILQVNKVMSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNK
LSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLS
DSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAID
IRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRAL
TSENNKLVGWRWIRIDTSCVCALSRKIGRT
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggttacttttgccacgatcttacaggtgaacaaggtgatgtccatcttgttttatgtg
atatttctcgcttatctccgtggcatccaaggtaacaacatggatcaaaggagtttgcca
gaagactcgctcaattccctcattattaagctgatccaggcagatattttgaaaaacaag
ctctccaagcagatggtggacgttaaggaaaattaccagagcaccctgcccaaagctgag
gctccccgagagccggagcggggagggcccgccaagtcagcattccagccggtgattgca
atggacaccgaactgctgcgacaacagagacgctacaactcaccgcgggtcctgctgagc
gacagcacccccttggagcccccgcccttgtatctcatggaggattacgtgggcagcccc
gtggtggcgaacagaacatcacggcggaaacggtacgcggagcataagagtcaccgaggg
gagtactcggtatgtgacagtgagagtctgtgggtgaccgacaagtcatcggccatcgac
attcggggacaccaggtcacggtgctgggggagatcaaaacgggcaactctcccgtcaaa
caatatttttatgaaacgcgatgtaaggaagccaggccggtcaaaaacggttgcaggggt
attgatgataaacactggaactctcagtgcaaaacatcccaaacctacgtccgagcactg
acttcagagaacaataaactcgtgggctggcggtggatacggatagacacgtcctgtgtg
tgtgccttgtcgagaaaaatcggaagaacatga

DBGET integrated database retrieval system