KEGG   Homo sapiens (human): 4908Help
Entry
4908              CDS       T01001                                 

Gene name
NTF3, HDNF, NGF-2, NGF2, NT-3, NT3
Definition
(RefSeq) neurotrophin 3
  KO
K04356  
neurotrophin 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4908 (NTF3)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4908 (NTF3)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    4908 (NTF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P20783(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 257 aa AA seqDB search
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcttgttttatgtgatatttctcgcttatctccgtggcatccaaggtaacaac
atggatcaaaggagtttgccagaagactcgctcaattccctcattattaagctgatccag
gcagatattttgaaaaacaagctctccaagcagatggtggacgttaaggaaaattaccag
agcaccctgcccaaagctgaggctccccgagagccggagcggggagggcccgccaagtca
gcattccagccggtgattgcaatggacaccgaactgctgcgacaacagagacgctacaac
tcaccgcgggtcctgctgagcgacagcacccccttggagcccccgcccttgtatctcatg
gaggattacgtgggcagccccgtggtggcgaacagaacatcacggcggaaacggtacgcg
gagcataagagtcaccgaggggagtactcggtatgtgacagtgagagtctgtgggtgacc
gacaagtcatcggccatcgacattcggggacaccaggtcacggtgctgggggagatcaaa
acgggcaactctcccgtcaaacaatatttttatgaaacgcgatgtaaggaagccaggccg
gtcaaaaacggttgcaggggtattgatgataaacactggaactctcagtgcaaaacatcc
caaacctacgtccgagcactgacttcagagaacaataaactcgtgggctggcggtggata
cggatagacacgtcctgtgtgtgtgccttgtcgagaaaaatcggaagaacatga

KEGG   Homo sapiens (human): 4909Help
Entry
4909              CDS       T01001                                 

Gene name
NTF4, GLC10, GLC1O, NT-4, NT-4/5, NT-5, NT4, NT5, NTF5
Definition
(RefSeq) neurotrophin 4
  KO
K12457  
neurotrophin 4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Disease
H00612  
Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4909 (NTF4)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4909 (NTF4)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    4909 (NTF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P34130(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 210 aa AA seqDB search
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL
TADAQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctccctctcccctcatgctccctccccatcctcctccttttcctcctccccagtgtg
ccaattgagtcccaacccccaccctcaacattgcccccttttctggcccctgagtgggac
cttctctccccccgagtagtcctgtctaggggtgcccctgctgggccccctctgctcttc
ctgctggaggctggggcctttcgggagtcagcaggtgccccggccaaccgcagccggcgt
ggggtgagcgaaactgcaccagcgagtcgtcggggtgagctggctgtgtgcgatgcagtc
agtggctgggtgacagaccgccggaccgctgtggacttgcgtgggcgcgaggtggaggtg
ttgggcgaggtgcctgcagctggcggcagtcccctccgccagtacttctttgaaacccgc
tgcaaggctgataacgctgaggaaggtggcccgggggcaggtggagggggctgccgggga
gtggacaggaggcactgggtatctgagtgcaaggccaagcagtcctatgtgcgggcattg
accgctgatgcccagggccgtgtgggctggcgatggattcgaattgacactgcctgcgtc
tgcacactcctcagccggactggccgggcctga

DBGET integrated database retrieval system