KEGG   Homo sapiens (human): 4913Help
Entry
4913              CDS       T01001                                 

Gene name
NTHL1, NTH1, OCTS3, hNTH1
Definition
nth endonuclease III-like 1 (E. coli) (EC:4.2.99.18)
Orthology
K10773  
endonuclease III [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    4913 (NTHL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4913 (NTHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 312 aa AA seqDB search
MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRK
AQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
SSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG
FWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHAC
LNQALCPAAQGL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtccgcaggagtccggcatgaccgccttgagcgcgaggatgctgacccggagc
cggagcctgggacccggggctgggccgcgggggtgtagggaggagcccgggcctctccgg
agaagagaggctgcagcagaagcgaggaaaagccacagccccgtgaagcgtccgcggaaa
gcacagagactgcgtgtggcctatgagggctcggacagtgagaaaggtgagggggctgag
cccctcaaggtgccagtctgggagccccaggactggcagcaacagctggtcaacatccgt
gccatgaggaacaaaaaggatgcacctgtggaccatctggggactgagcactgctatgac
tccagtgcccccccaaaggtacgcaggtaccaggtgctgctgtcactgatgctctccagc
caaaccaaagaccaggtgacggcgggcgccatgcagcgactgcgggcgcggggcctgacg
gtggacagcatcctgcagacagatgatgccacgctgggcaagctcatctaccccgtcggt
ttctggaggagcaaggtgaaatacatcaagcagaccagcgccatcctgcagcagcactac
ggtggggacatcccagcctctgtggccgagctggtggcgctgccgggtgttgggcccaag
atggcacacctggctatggctgtggcctggggcactgtgtcaggcattgcagtggacacg
catgtgcacagaatcgccaacaggctgaggtggaccaagaaggcaaccaagtccccagag
gagacccgcgccgccctggaggagtggctgcctagggagctgtggcacgagatcaatgga
ctcttggtgggcttcggccagcagacctgtctgcctgtgcaccctcgctgccacgcctgc
ctcaaccaagccctctgcccggccgcccagggtctctga

DBGET integrated database retrieval system