KEGG   Homo sapiens (human): 4916Help
Entry
4916              CDS       T01001                                 

Gene name
NTRK3, TRKC, gp145(trkC)
Definition
neurotrophic tyrosine kinase, receptor, type 3 (EC:2.7.10.1)
Orthology
K05101  
neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Disease
H00043  
Neuroblastoma
Class
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q25
AA seq 612 aa AA seqDB search
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTWVFSNIDNHGIL
NLKDNRDHLVPSTHYIYEEPEVQSGEVSYPRSHGFREIMLNPISLPGHSKPLNHGIYVED
VNVYFSKGRHGF
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccccctcctggaagggcag
gattcagggaacagcaatgggaacgccagtatcaacatcacggacatctcaaggaatatc
acttccatacacatagagaactggcgcagtcttcacacgctcaacgccgtggacatggag
ctctacaccggacttcaaaagctgaccatcaagaactcaggacttcggagcattcagccc
agagcctttgccaagaacccccatttgcgttatataaacctgtcaagtaaccggctcacc
acactctcgtggcagctcttccagacgctgagtcttcgggaattgcagttggagcagaac
tttttcaactgcagctgtgacatccgctggatgcagctctggcaggagcagggggaggcc
aagctcaacagccagaacctctactgcatcaacgctgatggctcccagcttcctctcttc
cgcatgaacatcagtcagtgtgaccttcctgagatcagcgtgagccacgtcaacctgacc
gtacgagagggtgacaatgctgttatcacttgcaatggctctggatcaccccttcctgat
gtggactggatagtcactgggctgcagtccatcaacactcaccagaccaatctgaactgg
accaatgttcatgccatcaacttgacgctggtgaatgtgacgagtgaggacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgccctcact
gtctactatcccccacgtgtggtgagcctggaggagcctgagctgcgcctggagcactgc
atcgagtttgtggtgcgtggcaaccccccaccaacgctgcactggctgcacaatgggcag
cctctgcgggagtccaagatcatccatgtggaatactaccaagagggagagatttccgag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactataccctcattgcc
aaaaacccactgggcacagccaaccagaccatcaatggccacttcctcaaggagcccttt
ccagagagcacggataactttatcttgtttgacgaagtgagtcccacacctcctatcact
gtgacccacaaaccagaagaagacacttttggggtatccatagcagttggacttgctgct
tttgcctgtgtcctgttggtggttctcttcgtcatgatcaacaaatatggtcgacggtcc
aaatttggaatgaagggtcccgtggctgtcatcagtggtgaggaggactcagccagccca
ctgcaccacatcaaccacggcatcaccacgccctcgtcactggatgccgggcccgacact
gtggtcattggcatgactcgcatccctgtcattgagaacccccagtacttccgtcaggga
cacaactgccacaagccggacacgtgggtcttttcaaacatagacaatcatgggatatta
aacttgaaggacaatagagatcatctagtcccatcaactcactatatatatgaggaacct
gaggtccagagtggggaagtgtcttacccaaggtcacatggtttcagagaaattatgttg
aatccaataagccttcccggacattccaagcctcttaaccatggcatctatgttgaggat
gtcaatgtttatttcagcaaaggacgtcatggcttttaa

DBGET integrated database retrieval system