KEGG   Homo sapiens (human): 4916Help
Entry
4916              CDS       T01001                                 

Gene name
NTRK3, GP145-TrkC, TRKC, gp145(trkC)
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 3
  KO
K05101  neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
hsa05230  Central carbon metabolism in cancer
Disease
H00043  Neuroblastoma
H01508  Salivary gland cancer
Drug target
Entrectinib: D10926
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4916 (NTRK3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    4916 (NTRK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4916 (NTRK3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases
  TRK family [OT]
   4916 (NTRK3)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   4916 (NTRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set TPKR_C2 ig Ig_3 LRR_8 Ig_2 C2-set_2 LRRNT LRR_4 LRR_5 Haspin_kinase LRR_6
Motif
Other DBs
NCBI-GeneID: 4916
NCBI-ProteinID: NP_001012338
OMIM: 191316
HGNC: 8033
Ensembl: ENSG00000140538
Vega: OTTHUMG00000148677
Pharos: Q16288(Tchem)
UniProt: Q16288 X5D2R1
Structure
PDB: 

Jmol
Position
15q25.3
AA seq 839 aa AA seqDB search
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccccctcctggaagggcag
gattcagggaacagcaatgggaacgccagtatcaacatcacggacatctcaaggaatatc
acttccatacacatagagaactggcgcagtcttcacacgctcaacgccgtggacatggag
ctctacaccggacttcaaaagctgaccatcaagaactcaggacttcggagcattcagccc
agagcctttgccaagaacccccatttgcgttatataaacctgtcaagtaaccggctcacc
acactctcgtggcagctcttccagacgctgagtcttcgggaattgcagttggagcagaac
tttttcaactgcagctgtgacatccgctggatgcagctctggcaggagcagggggaggcc
aagctcaacagccagaacctctactgcatcaacgctgatggctcccagcttcctctcttc
cgcatgaacatcagtcagtgtgaccttcctgagatcagcgtgagccacgtcaacctgacc
gtacgagagggtgacaatgctgttatcacttgcaatggctctggatcaccccttcctgat
gtggactggatagtcactgggctgcagtccatcaacactcaccagaccaatctgaactgg
accaatgttcatgccatcaacttgacgctggtgaatgtgacgagtgaggacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgccctcact
gtctactatcccccacgtgtggtgagcctggaggagcctgagctgcgcctggagcactgc
atcgagtttgtggtgcgtggcaaccccccaccaacgctgcactggctgcacaatgggcag
cctctgcgggagtccaagatcatccatgtggaatactaccaagagggagagatttccgag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactataccctcattgcc
aaaaacccactgggcacagccaaccagaccatcaatggccacttcctcaaggagcccttt
ccagagagcacggataactttatcttgtttgacgaagtgagtcccacacctcctatcact
gtgacccacaaaccagaagaagacacttttggggtatccatagcagttggacttgctgct
tttgcctgtgtcctgttggtggttctcttcgtcatgatcaacaaatatggtcgacggtcc
aaatttggaatgaagggtcccgtggctgtcatcagtggtgaggaggactcagccagccca
ctgcaccacatcaaccacggcatcaccacgccctcgtcactggatgccgggcccgacact
gtggtcattggcatgactcgcatccctgtcattgagaacccccagtacttccgtcaggga
cacaactgccacaagccggacacgtatgtgcagcacattaagaggagagacatcgtgctg
aagcgagaactgggtgagggagcctttggaaaggtcttcctggccgagtgctacaacctc
agcccgaccaaggacaagatgcttgtggctgtgaaggccctgaaggatcccaccctggct
gcccggaaggatttccagagggaggccgagctgctcaccaacctgcagcatgagcacatt
gtcaagttctatggagtgtgcggcgatggggaccccctcatcatggtctttgaatacatg
aagcatggagacctgaataagttcctcagggcccatgggccagatgcaatgatccttgtg
gatggacagccacgccaggccaagggtgagctggggctctcccaaatgctccacattgcc
agtcagatcgcctcgggtatggtgtacctggcctcccagcactttgtgcaccgagacctg
gccaccaggaactgcctggttggagcgaatctgctagtgaagattggggacttcggcatg
tccagagatgtctacagcacggattattacaggctctttaatccatctggaaatgatttt
tgtatatggtgtgaggtgggaggacacaccatgctccccattcgctggatgcctcctgaa
agcatcatgtaccggaagttcactacagagagtgatgtatggagcttcggggtgatcctc
tgggagatcttcacctatggaaagcagccatggttccaactctcaaacacggaggtcatt
gagtgcattacccaaggtcgtgttttggagcggccccgagtctgccccaaagaggtgtac
gatgtcatgctggggtgctggcagagggaaccacagcagcggttgaacatcaaggagatc
tacaaaatcctccatgctttggggaaggccaccccaatctacctggacattcttggctag

DBGET integrated database retrieval system