KEGG   Homo sapiens (human): 4926Help
Entry
4926              CDS       T01001                                 

Gene name
NUMA1, NUMA
Definition
nuclear mitotic apparatus protein 1
Orthology
K16808  
nuclear mitotic apparatus protein 1
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 2101 aa AA seqDB search
MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER
LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE
YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR
FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN
RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ
DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA
QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ
EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ
AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ
QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD
AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE
TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE
EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA
ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE
ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD
DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF
CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL
ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL
EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ
EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ
DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE
KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE
RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR
HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML
KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS
TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEELSKKLADSDQASKVQQQKLKA
VQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTHYDAKKQQNQELQEQ
LRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQVRSLEAQVAHADQQL
RDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSKLPRTQPDGTSVPGE
PASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQI
INITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLP
GYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHL
KTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTGITTRQQRKRVSLEP
HQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILN
TPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATAAAIGATPRAKGKAK
H
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atgacactccacgccacccggggggctgcactcctctcttgggtgaacagtctacacgtg
gctgaccctgtggaggctgtgctgcagctccaggactgcagcatcttcatcaagatcatt
gacagaatccatggcactgaagagggacagcaaatcttgaagcagccggtgtcagagaga
ctggactttgtgtgcagttttctgcagaaaaatcgaaaacatccctcttccccagaatgc
ctggtatctgcacagaaggtgctagagggatcagagctggaactggcgaagatgaccatg
ctgctcttataccactctaccatgagctccaaaagtcccagggactgggaacagtttgaa
tataaaattcaggctgagttggctgtcattcttaaatttgtgctggaccatgaggacggg
ctaaaccttaatgaggacctagagaacttcctacagaaagctcctgtgccttctacctgt
tctagcacattccctgaagagctctccccacctagccaccaggccaagagggagattcgc
ttcctagagctacagaaggttgcctcctcttccagtgggaacaactttctctcaggttct
ccagcttctcccatgggtgatatcctgcagaccccacagttccagatgagacggctgaag
aagcagcttgctgatgagagaagtaatagggatgagctggagctggagctagctgagaac
cgcaagctcctcaccgagaaggatgcacagatagccatgatgcagcagcgcattgaccgc
ctagccctgctgaatgagaagcaggcggccagcccactggagcccaaggagcttgaggag
ctgcgtgacaagaatgagagccttaccatgcggctgcatgaaaccctgaagcagtgccag
gacctgaagacagagaagagccagatggatcgcaaaatcaaccagctttcggaggagaat
ggagacctttcctttaagctgcgggagtttgccagtcatctgcagcagctacaggatgcc
ctcaatgagctgacggaggagcacagcaaggccactcaggagtggctagagaagcaggcc
cagctggagaaggagctcagcgcagccctgcaggacaagaaatgccttgaagagaagaac
gaaatccttcagggaaaactttcacagctggaagaacacttgtcccagctgcaggataac
ccaccccaggagaagggcgaggtgctgggtgatgtcttgcagctggaaaccttgaagcaa
gaggcagccactcttgctgcaaacaacacacagctccaagccagggtagagatgctggag
actgagcgaggccagcaggaagccaagctgcttgctgagcggggccacttcgaagaagaa
aagcagcagctgtctagcctgatcactgacctgcagagctccatctccaacctcagccag
gccaaggaagagctggagcaggcctcccaggctcatggggcccggttgactgcccaggtg
gcctctctgacctctgagctcaccacactcaatgccaccatccagcaacaggatcaagaa
ctggctggcctgaagcagcaggccaaagagaagcaggcccagctagcacagaccctccaa
cagcaagaacaggcctcccagggcctccgccaccaggtggagcagctaagcagtagcctg
aagcagaaggagcagcagttgaaggaggtagcggagaagcaggaggcaactaggcaggac
catgcccagcaactggccactgctgcagaggagcgagaggcctccttaagggagcgggat
gcggctctcaagcagctggaggcactggagaaggagaaggctgccaagctggagattctg
cagcagcaacttcaggtggctaatgaagcccgggacagtgcccagacctcagtgacacag
gcccagcgggagaaggcagagctgagccggaaggtggaggaactccaggcctgtgttgag
acagcccgccaggaacagcatgaggcccaggcccaggttgcagagctagagttgcagctg
cggtctgagcagcaaaaagcaactgagaaagaaagggtggcccaggagaaggaccagctc
caggagcagctccaggccctcaaagagtccttgaaggtcaccaagggcagccttgaagag
gagaagcgcagggctgcagatgccctggaagagcagcagcgttgtatctctgagctgaag
gcagagacccgaagcctggtggagcagcataagcgggaacgaaaggagctggaagaagag
agggctgggcgcaaggggctggaggctcgattacagcagcttggggaggcccatcaggct
gagactgaagtcctgcggcgggagctggcagaggccatggctgcccagcacacagctgag
agtgagtgtgagcagctcgtcaaagaagtagctgcctggcgtgagcggtatgaggatagc
cagcaagaggaggcacagtatggcgccatgttccaggaacagctgatgactttgaaggag
gaatgtgagaaggcccgccaggagctgcaggaggcaaaggagaaggtggcaggcatagaa
tcccacagcgagctccagataagccggcagcagaacgaactagctgagctccatgccaac
ctggccagagcactccagcaggtccaagagaaggaagtcagggcccagaagcttgcagat
gacctctccactctgcaggaaaagatggctgccaccagcaaagaggtggcccgcttggag
accttggtgcgcaaggcaggtgagcagcaggaaacagcctcccgggagttagtcaaggag
cctgcgagggcaggagacagacagcccgagtggctggaagagcaacagggacgccagttc
tgcagcacacaggcagcgctgcaggctatggagcgggaggcagagcagatgggcaatgag
ctggaacggctgcgggccgcgctgatggagagccaggggcagcagcaggaggagcgtggg
cagcaggaaagggaggtggcgcggctgacccaggagcggggccgtgcccaggctgacctt
gccctggagaaggcggccagagcagagcttgagatgcggctgcagaacgccctcaacgag
cagcgtgtggagttcgctaccctgcaagaggcactggctcatgccctgacggaaaaggaa
ggcaaggaccaggagttggccaagcttcgtggtctggaggcagcccagataaaagagctg
gaggaacttcggcaaaccgtgaagcaactgaaggaacagctggctaagaaagaaaaggag
cacgcatctggctcaggagcccaatctgaggctgctggcaggacagagccaacaggcccc
aagctggaggcactgcgggcagaggtgagcaagctggaacagcaatgccagaagcagcag
gagcaggctgacagcctggaacgcagcctcgaggctgagcgggcctcccgggctgagcgg
gacagtgctctggagactctgcagggccagttagaggagaaggcccaggagctagggcac
agtcagagtgccttagcctcggcccaacgggagttggctgccttccgcaccaaggtacaa
gaccacagcaaggctgaagatgagtggaaggcccaggtggcccggggccggcaagaggct
gagaggaaaaatagcctcatcagcagcttggaggaggaggtgtccatcctgaatcgccag
gtcctggagaaggagggggagagcaaggagttgaagcggctggtgatggccgagtcagag
aagagccagaagctggaggagaggctgcgcctgctgcaggcagagacagccagcaacagt
gccagagctgcagaacgcagctctgctctgcgggaggaggtgcagagcctccgggaggag
gctgagaaacagcgggtggcttcagagaacctgcggcaggagctgacctcacaggctgag
cgtgcggaggagctgggccaagaattgaaggcgtggcaggagaagttcttccagaaagag
caggccctctccaccctgcagctcgagcacaccagcacacaggccctggtgagtgagctg
ctgccagctaagcacctctgccagcagctgcaggccgagcaggccgctgccgagaaacgc
caccgtgaggagctggagcagagcaagcaggccgctgggggactgcgggcagagctgctg
cgggcccagcgggagcttggggagctgattcctctgcggcagaaggtggcagagcaggag
cgaacagctcagcagctgcgggcagagaaggccagctatgcagagcagctgagcatgctg
aagaaggcgcatggcctgctggcagaggagaaccgggggctgggtgagcgggccaacctt
ggccggcagtttctggaagtggagttggaccaggcccgggagaagtatgtccaagagttg
gcagccgtacgtgctgatgctgagacccgtctggctgaggtgcagcgagaagcacagagc
actgcccgggagctggaggtgatgactgccaagtatgagggtgccaaggtcaaggtcctg
gaggagaggcagcggttccaggaagagaggcagaaactcactgcccaggtggaagaactg
agtaagaaactggctgactctgaccaagccagcaaggtgcagcagcagaagctgaaggct
gtccaggctcagggaggcgagagccagcaggaggcccagcgcctccaggcccagctgaat
gaactgcaagcccagttgagccagaaggagcaggcagctgagcactataagctgcagatg
gagaaagccaaaacacattatgatgccaagaagcagcagaaccaagagctgcaggagcag
ctgcggagcctggagcagctgcagaaggaaaacaaagagctgcgagctgaagctgaacgg
ctgggccatgagctacagcaggctgggctgaagaccaaggaggctgaacagacctgccgc
caccttactgcccaggtgcgcagcctggaggcacaggttgcccatgcagaccagcagctt
cgagacctgggcaaattccaggtggcaactgatgctttaaagagccgtgagccccaggct
aagccccagctggacttgagtattgacagcctggatctgagctgcgaggaggggacccca
ctcagtatcaccagcaagctgcctcgtacccagccagacggcaccagcgtccctggagaa
ccagcctcacctatctcccagcgcctgccccccaaggtagaatccctggagagtctctac
ttcactcccatccctgctcggagtcaggcccccctggagagcagcctggactccctggga
gacgtcttcctggactcgggtcgtaagacccgctccgctcgtcggcgcaccacgcagatc
atcaacatcaccatgaccaagaagctagatgtggaagagccagacagcgccaactcatcg
ttctacagcacgcggtctgctcctgcttcccaggctagcctgcgagccacctcctctact
cagtctctagctcgcctgggttctcccgattatggcaactcagccctgctcagcttgcct
ggctaccgccccaccactcgcagttctgctcgtcgttcccaggccggggtgtccagtggg
gcccctccaggaaggaacagcttctacatgggcacttgccaggatgagcctgagcagctg
gatgactggaaccgcattgcagagctgcagcagcgcaatcgagtgtgccccccacatctg
aagacctgctatcccctggagtccaggccttccctgagcctgggcaccatcacagatgag
gagatgaaaactggagacccccaagagaccctgcgccgagccagcatgcagccaatccag
atagccgagggcactggcatcaccacccggcagcagcgcaaacgggtctccctagagccc
caccagggccctggaactcctgagtctaagaaggccaccagctgtttcccacgccccatg
actccccgagaccgacatgaagggcgcaaacagagcactactgaggcccagaagaaagca
gctccagcttctactaaacaggctgaccggcgccagtcgatggccttcagcatcctcaac
acacccaagaagctagggaacagccttctgcggcggggagcctcaaagaaggccctgtcc
aaggcttcccccaacactcgcagtggaacccgccgttctccgcgcattgccaccaccaca
gccagcgccgccactgctgccgccattggtgccacccctcgagccaagggcaaggcaaag
cactaa

DBGET integrated database retrieval system