KEGG   Homo sapiens (human): 4927Help
Entry
4927              CDS       T01001                                 

Gene name
NUP88
Definition
nucleoporin 88kDa
Orthology
K14318  
nuclear pore complex protein Nup88
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.2
AA seq 741 aa AA seqDB search
MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNV
VFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQ
HHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYP
SEILDPHVVLLTSDNVIRIYSLREPQTPTNVIILSEAEEESLVLNKGRAYTASLGETAVA
FDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTYISLLHSPGNIGKLLGPLPMH
PAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLI
PSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW
IHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTM
ICITSTYECLIWPLLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRS
VANPAFLKASEKDIAPPPEECLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCDQKKK
QLEDLSYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKLLHSFHSELPVLSDSERD
MKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQSILKE
EGEHIREMVKQINDIRNHVNF
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgagggaccggtgggcgacggcgagctgtggcagacctggcttcctaac
cacgtcgtgttcttgcggctccgggagggactgaaaaaccagagtccaaccgaagctgag
aaaccagcttcttcgtcgttgccttcgtcgccgccgccgcagttgctgacgagaaacgtg
gtctttggcctcggcggagagcttttcctgtgggacggagaagacagctccttcttagtc
gttcgccttcggggccccagcggcggcggcgaagagcccgccctgtcccagtaccagaga
ttgctttgcataaatccacccctgtttgaaatctatcaagtcttgttaagcccaacacaa
catcatgtagcacttataggaataaaaggacttatggtattagaattacctaaaagatgg
gggaagaattctgaatttgaaggtggaaaatcaacagtgaattgtagtaccactccagtt
gcggagagatttttcaccagttccacctctctgactctaaagcatgctgcatggtatcca
agtgaaatcctggatccccacgtagtgctgttaacatcagacaacgtaatcagaatttac
tcactacgtgagccgcagacacccactaacgtgataatactttcagaagccgaagaggaa
agtctagtactcaataaaggaagggcgtataccgcatctctaggagagacagcagttgca
tttgactttgggccattggcagcagtcccaaagactctatttggacaaaacggcaaagat
gaagtagtggcatacccactgtacatcttatatgaaaatggagagactttcctgacatac
atcagtctgttacacagccctggaaatattggaaagctgttgggtccattgcccatgcat
cctgcggctgaagataactatggttatgatgcgtgtgctgtactctgcttaccctgtgtc
cccaatatcttagtgatcgctactgaatcaggaatgctgtatcactgtgtcgtgctagaa
ggggaagaagaagatgaccacacgtcagaaaagtcctgggattccaggattgacctcatt
ccttctctgtatgtgtttgaatgtgttgagttggagcttgctttgaaactggcatctgga
gaggatgacccttttgattctgacttttcttgtccagtcaaacttcatagagatcccaag
tgtccttcaagatatcactgtactcatgaagctggtgtacatagtgttgggctaacttgg
attcataaacttcacaaatttcttggatcagatgaagaagataaggatagtttacaggaa
ctctctacagaacagaaatgctttgttgaacacatcctttgtacgaagccattgccctgc
aggcagccagctccaattcgaggattttggattgtacctgacattctgggacccacgatg
atctgcatcaccagtacctatgaatgcctcatatggccgttattaagtacagtccatcca
gcgtctcctcccctgctttgtactcgagaagatgttgaagtggcagagtctcccctccgt
gttctggctgaaaccccagattcctttgaaaagcatattagaagcattttgcaacgtagt
gttgccaatccagcatttttgaaagcttctgaaaaggacatagcccctcctcctgaagaa
tgccttcagctcctcagcagagccacccaggtgttcagagagcagtacattctcaaacag
gacttggcaaaggaggagattcagcggagggtcaaattattatgtgaccaaaaaaagaaa
caactagaagatctcagttattgtcgagaagagaggaaaagtctgcgggaaatggctgag
cgtttagctgacaaatatgaggaagctaaagaaaaacaagaggatatcatgaacaggatg
aaaaaactacttcacagttttcactctgagctcccagttctctctgatagtgagcgagac
atgaagaaagaattacagctgatacctgatcaacttcgacatttgggcaatgccatcaaa
caggttactatgaaaaaggattatcaacagcaaaagatggagaaggtgttgagtcttcca
aaacccaccattattctcagtgcctaccagcgaaagtgcattcagtccatcctgaaagag
gagggtgaacatataagggaaatggtgaagcaaatcaatgatatccgcaatcatgtaaac
ttctga

DBGET integrated database retrieval system