KEGG   Homo sapiens (human): 4928Help
Entry
4928              CDS       T01001                                 

Gene name
NUP98, ADIR2, NUP196, NUP96
Definition
(RefSeq) nucleoporin 98
  KO
K14297  
nuclear pore complex protein Nup98-Nup96
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4928 (NUP98)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    4928 (NUP98)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     4928 (NUP98)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    4928 (NUP98)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P52948(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 1800 aa AA seqDB search
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGL
FSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAV
GSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGFGTNTSGNSIFGSKPAPGTLGTGLGAGF
GTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQ
QAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPA
TRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRD
SENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNK
HSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILT
KVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRK
EVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSR
KQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTP
LQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSAS
THIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASH
SSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTM
PSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSG
EQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKLYQT
PLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCE
ALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSY
LTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLR
IFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTS
DSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITA
DPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGI
REKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCL
FKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYI
RVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRV
VLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaaatcatttggaacaccctttgggggtggcacaggtggctttggcacaact
tcaacatttggacagaatactggctttggcactactagtggaggggcatttggaacatct
gcatttggttctagcaacaatactggaggcctctttggaaattcacagactaaaccagga
ggattgtttggaaccagttcatttagccagccagctacctccacaagcactggctttggg
tttggtacgtcaacaggaacagcaaataccttgtttggaactgcaagcacagggaccagt
ctcttctcatcccaaaacaatgcctttgcacaaaataaaccaactggctttggcaatttt
ggaaccagtactagcagtggaggactctttggaaccacaaataccacctctaatcctttt
ggcagcacatctggctccctctttgggccaagtagttttacagctgctcctactgggact
actattaaatttaaccctccaactggtacagatactatggtcaaagctggagttagcact
aacataagtaccaagcaccagtgtattactgctatgaaagaatatgaaagcaagtcacta
gaggaacttcgtttagaggattatcaggctaacaggaagggcccacagaaccaggtggga
gcaggtaccacaactggcttgtttgggtcttctccagccacttccagcgcaacaggactc
ttcagctcctccaccactaattcaggctttgcatatggtcagaacaaaactgcctttgga
actagtacaactggatttggaacaaatccaggtggtctctttggccaacagaatcagcag
actaccagcctcttcagcaaaccatttggccaggctacaaccacccagaacactggcttt
tcctttggtaataccagcaccataggacagccaagcaccaacaccatgggattatttgga
gtaacccaagcctcacagcctggaggtctttttgggacagctacaaacaccagcactggg
acagcatttggaacaggaacaggtctctttgggcagaccaatactggatttggtgctgtt
ggttcgaccctgtttggcaataacaagcttactacatttggaagcagcacaaccagtgca
ccttcatttggtacaaccagtggcgggctctttggttttggcacaaataccagtgggaat
agtatttttggaagtaaaccagcacctgggactcttggaactgggcttggtgcaggattt
ggaacagctcttggtgctggacaggcatctttgtttgggaacaaccaacctaagattgga
gggcctcttggtacaggagcctttggggcccctggatttaatactacgacagccactttg
ggctttggagccccccaggccccagtagctttgacagatccaaatgcttctgctgcccag
caggctgttctccagcagcacatcaatagtctaacatactcaccttttggagactctcct
ctcttccggaatccgatgtcagaccctaagaagaaggaagagagattgaaaccaacaaat
ccagcagcccagaaggctcttactacacctactcattataaactgacaccccgccctgcc
actagagtccggccaaaggctttacaaacaacaggcacagccaagtcacatctctttgat
gggctggatgacgatgaaccatccctagccaatggagcattcatgcccaagaagagcatt
aagaagttggttttgaagaaccttaataatagcaatctcttttctcctgttaatcgtgat
tcagaaaatctagcttcaccatctgaatatccagaaaatggagagagatttagtttccta
agcaaacctgttgatgagaatcaccagcaggatggagatgaagattcccttgtttcacat
ttttatactaaccctattgccaaacctattcctcaaaccccagaaagtgctggaaataaa
cacagcaacagcaacagtgtggatgataccattgttgcattaaacatgcgtgctgctttg
cgaaatgggctggaaggaagcagtgaagaaacgtcttttcatgatgagtcacttcaggat
gaccgagaagaaatagaaaataattcttaccatatgcacccagcaggtattattctcact
aaggttggttactatactattccatctatggatgaccttgctaaaattaccaatgaaaaa
ggagagtgcattgtctctgatttcactattggtcggaaaggttatggttcaatctatttt
gaaggagatgtgaatttgacaaatctaaatttggatgatattgtgcatatccggaggaaa
gaagtagttgtctacttagatgataaccaaaaaccacctgtgggtgaagggctaaatagg
aaggctgaagttacattggatggagtttggccaacagataaaacatctcgttgtttaata
aagagcccagatcgccttgctgatatcaactatgaaggaagattggaagcagtttcaagg
aaacagggagctcaattcaaagaataccggcctgaaactggttcttgggtgtttaaggtc
tcccatttttctaagtatggccttcaggattctgatgaagaggaggaggagcatccgtct
aaaactagtacaaagaagttgaagactgctcctttgcctcctgcaagccagactacgccc
ttgcagatggctcttaatggcaaacctgcacctccacctcagagccagagcccagaggtg
gagcagttagggagggttgtggaactggacagtgacatggtagatatcacccaggagcca
gttttggataccatgttagaagagagcatgcctgaggatcaggaacctgtgtctgcctca
acacatattgcatcttcactgggaattaatccacatgtcttacagatcatgaaagcatca
ttgcttactgatgaagaagatgtagatatggcactggatcaacgcttcagtcgcctgcct
tccaaagcagatacttctcaagaaatctgttctcccagactccccatttcagcatcccac
tcgtcgaaaactcgttcactagttggtgggttactacaatcaaaatttacaagtggagct
tttctttcaccaagtgtctctgtgcaagaatgtcgtactcccagagcagcatctttaatg
aatatcccatccacatcctcttggtctgtccctccacccctgacttctgtgttcacaatg
cccagcccagcccctgaggttccgttgaaaacagtgggtacacgtaggcaactaggccta
gtccctcgtgaaaagtctgtcacctatggcaagggaaaactcttgatggacatggcccta
ttcatgggacgctcatttcgtgttggttggggccccaactggactcttgctaatagtgga
gaacagctgaatggctctcatgaactagaaaatcatcagattgccgattccatggagttt
ggattcctgcccaatccagtagctgttaaacccctaactgagtccccattcaaagttcac
ttagaaaaactcagtttgagacaaagaaagccagatgaagacatgaaattatatcagaca
cctctggagctcaaattaaaacacagcactgtccatgtggatgaactgtgtcctctcatt
gtccccaatctgggagttgctgtcattcatgactatgcagattgggttaaagaagcatca
ggagacttaccagaagcacaaattgtgaagcactggagcctgacatggacactatgtgaa
gccctatggggccacctgaaggagcttgacagccagctaaatgaaccccgtgaatacatt
caaattctggagcgaagaagagctttctcccgctggctatcctgtactgccacacctcag
attgaagaggaagtctccttaacccaaaaaaacagccctgtggaggctgtattcagctac
ctcacaggcaaaaggatcagtgaggcctgctctctggcccagcagtcaggggatcatcgt
cttgctcttcttttatctcagtttgtgggtagccagtcagtccgggagctgctcaccatg
cagttggtggactggcatcagctccaagcagactccttcatccaggatgagagactgcgc
atctttgctctgttggctggaaaaccggtgtggcagctctcagaaaagaagcaaataaac
gtgtgctcccagttggattggaaacgctccctggctatccatctttggtatttgcttcca
ccaacagcctccatttctagggcgctcagcatgtatgaagaagcatttcagaatacctct
gacagtgacagatatgcctgctccccacttccttcgtatctggagggttctggctgtgtg
atagcggaggagcaaaactcacagacaccacttcgagatgtctgctttcaccttctaaaa
ctctacagtgacagacattatgatctcaaccagctgctggagcctcgaagcataacagca
gatcctttggactaccgcctaagctggcacttgtgggaagtgctgagggctcttaactac
acccatctctcagcgcagtgtgaaggtgtgctacaggccagttacgctggccagcttgaa
agtgaggggctctgggagtgggccatctttgtcctcctgcacattgacaactcaggcata
cgtgagaaggctgttcgagagctgcttacccggcactgccagctgttggagacccctgaa
tcttgggctaaagagactttccttacccagaagctccgtgtacctgccaaatggatccac
gaggccaaagctgtgcgagcacacatggaatctgacaagcacttagaggccctttgctta
tttaaggctgagcactggaaccgctgccacaagctcatcatccgacacttagcttctgat
gccatcattaatgagaactatgactacctgaaggggttcttggaagacctggcacctcca
gagcgcagcagcctaattcaggattgggaaacatctgggcttgtttacctggactatatt
agagtcattgaaatgctccgccatatacagcaggtggattgctcaggtaatgacctggag
cagttacacatcaaagtgacttcactgtgcagtcggatagagcagattcagtgttacagt
gctaaagatcgcctggctcagtcagacatggccaaacgtgtagccaacctgctgcgcgtg
gtgctgagtctgcatcatcctcctgatagaacctccgactcaacaccagaccctcagcga
gtccctttgcgcctcttggctccccacattggccggcttcccatgcctgaggactatgcc
atggacgaactgcgcagccttacccagtcctatctgcgagaactggctgttgggagcctg
tga

DBGET integrated database retrieval system