KEGG   Homo sapiens (human): 4931Help
Entry
4931              CDS       T01001                                 

Gene name
NVL, NVL2
Definition
(RefSeq) nuclear VCP-like
  KO
K14571  
ribosome biogenesis ATPase
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    4931 (NVL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    4931 (NVL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.11
AA seq 856 aa AA seqDB search
MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVE
KVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMN
SSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPS
VKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDG
EIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRG
VLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCI
IFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL
RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCRE
AAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP
LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAP
VRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESE
RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFI
MAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIA
GDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
KKDQIMYERLQESLSR
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagacctgcagggttcgtggataataaactcaagcagcgagtcatccagtac
cttaccagtaacaaatgtggcaaatatgtggacattggagtcttagcgtctgatttacaa
agagtgtacagtatagactatggtcgaagaaaaagaaatgcttttaggattcaggtagaa
aaagtatttagcataattagtagtgagaaggaacttaagaatttaacagaattagaagat
gaacatttggcaaaaagggcaagacaaggtgaagaggataatgagtatactgaaagctat
tctgatgatgattcaagtatggaagactacccagatccacagtcagcaaatcacatgaac
agttccctgctgtctttatatcggaaaggaaatcctgattctgtttcaaatactcctgag
atggagcaaagagaaaccacctcttcaacaccacggataagttccaaaacaggctccatt
cccttgaagacccctgccaaagattctgaaggaggatggtttattgacaaaaccccaagt
gtaaagaaagacagttttttcttggacctgtcatgtgagaaaagtaatcctaagaagcca
ataactgagatacaggattcaaaagattcttctcttttggagagtgatatgaaacggaaa
ggcaagctaaagaataaaggaagcaaaaggaagaaagaagatcttcaggaagtagatgga
gaaattgaagctgtcctgcaaaagaaagctaaagccagggggttagaattccagatctcc
aacgtgaagtttgaagatgtgggaggcaatgatatgacattaaaagaggtctgcaagatg
ctcatacacatgcgtcacccggaggtgtaccaccacctgggcgtcgtgccccctcgtgga
gttctccttcatggaccaccaggctgtgggaagacattacttgcacatgcaattgctggg
gaacttgacctgccaattttgaaagtggctgctccagagattgtgtctggagtatccgga
gagtctgagcagaagctgagagaactatttgagcaagctgtgtcaaatgcaccatgtatc
attttcattgatgaaattgatgctattacccccaaaagagaagtggcttcaaaagatatg
gaacgaagaattgtagcccaactcctaacctgcatggatgatctgaataatgtggctgct
acagcccgggtcctagttattggagctactaatcgaccagactcgttagaccctgctttg
agacgtgcgggaaggttcgaccgagaaatatgcctaggtatcccagatgaagcatccagg
gaaagaatacttcaaacattgtgcagaaaactgaggcttcctcaagcttttgatttctgt
cacttagcacacctaactccaggctttgttggtgctgatctcatggcactgtgccgagag
gcagcaatgtgtgcagtcaatagagtcttaatgaagctacaggaacagcagaagaaaaat
cctgaaatggaagatttgccatctaaaggagtccaggaggaaaggctgggaactgagccc
acttctgaaacacaggatgaattacaaaggctgctggggttgctaagagaccaagatccc
ctctcagaggagcagatgcaaggactgtgcattgaactgaatgatttcattgttgctcta
tcctcagtccaaccctctgccaaaagggaaggctttgtcactgtccctaatgtgacatgg
gcagatattggtgccctggaagacattagagaggagctcaccatggcaatattggcacca
gtacgcaacccagaccagttcaaagctcttggattggtgactccagctggggtcctcctt
gctggtcctcctggctgtgggaagactctgctggcgaaggctgttgcaaatgagtccgga
ctaaattttatatctgtcaagggccccgaattactaaacatgtatgttggtgagagtgaa
cgtgctgtgcgacaagtttttcaacgagccaagaactcagcaccctgtgtgatattcttt
gatgaagtggatgctttatgtcctcgaagatcagaccgagagacaggggcaagtgtccga
gtggtgaatcagctacttacagagatggatggtctggaagcacgccagcaggtttttatt
atggcagccactaacaggccagatataattgaccctgcaatcctgcgcccgggccgcctg
gacaaaacactgtttgtgggtttaccgccccctgcagatcgccttgccatcttaaaaact
atcacaaaaaatggtaccaaaccaccactggatgcagatgtaaatttggaagcaattgct
ggtgaccttcgctgtgattgctatacgggcgcagatctctctgctttggtacgagaagct
tctatctgtgccctgagacaggaaatggcaagacagaagagtggaaatgaaaaaggtgaa
ctcaaggttagtcataagcattttgaagaagctttcaagaaagtaagatcatctatatca
aaaaaggatcaaatcatgtatgaacgtttgcaggagtccctcagccggtga

DBGET integrated database retrieval system