KEGG   Homo sapiens (human): 4931Help
Entry
4931              CDS       T01001                                 

Gene name
NVL
Definition
nuclear VCP-like
Orthology
K14571  
ribosome biogenesis ATPase
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41-q42.2
AA seq 667 aa AA seqDB search
MKRKGKLKNKGSKRKKEDLQEVDGEIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKE
VCKMLIHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGAECSGMITAHCSFDFS
GSNDPPASASQELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAI
TPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDRE
ICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRV
LMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGL
CIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKA
LGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQR
AKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDI
IDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIAGDLRCDCYT
GADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYER
LQESLSR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaaaggcaagctaaagaataaaggaagcaaaaggaagaaagaagatcttcag
gaagtagatggagaaattgaagctgtcctgcaaaagaaagctaaagccagggggttagaa
ttccagatctccaacgtgaagtttgaagatgtgggaggcaatgatatgacattaaaagag
gtctgcaagatgctcatacacatgcgtcacccggaggtgtaccaccacctgggcgtcgtg
ccccctcgtggagttctccttcatggaccaccaggctgtgggaagacattacttgcacat
gcaattgctggggctgagtgcagtggcatgatcacagctcactgcagctttgacttctca
ggctcaaatgatcctcctgcctcagcctcacaggaacttgacctgccaattttgaaagtg
gctgctccagagattgtgtctggagtatccggagagtctgagcagaagctgagagaacta
tttgagcaagctgtgtcaaatgcaccatgtatcattttcattgatgaaattgatgctatt
acccccaaaagagaagtggcttcaaaagatatggaacgaagaattgtagcccaactccta
acctgcatggatgatctgaataatgtggctgctacagcccgggtcctagttattggagct
actaatcgaccagactcgttagaccctgctttgagacgtgcgggaaggttcgaccgagaa
atatgcctaggtatcccagatgaagcatccagggaaagaatacttcaaacattgtgcaga
aaactgaggcttcctcaagcttttgatttctgtcacttagcacacctaactccaggcttt
gttggtgctgatctcatggcactgtgccgagaggcagcaatgtgtgcagtcaatagagtc
ttaatgaagctacaggaacagcagaagaaaaatcctgaaatggaagatttgccatctaaa
ggagtccaggaggaaaggctgggaactgagcccacttctgaaacacaggatgaattacaa
aggctgctggggttgctaagagaccaagatcccctctcagaggagcagatgcaaggactg
tgcattgaactgaatgatttcattgttgctctatcctcagtccaaccctctgccaaaagg
gaaggctttgtcactgtccctaatgtgacatgggcagatattggtgccctggaagacatt
agagaggagctcaccatggcaatattggcaccagtacgcaacccagaccagttcaaagct
cttggattggtgactccagctggggtcctccttgctggtcctcctggctgtgggaagact
ctgctggcgaaggctgttgcaaatgagtccggactaaattttatatctgtcaagggcccc
gaattactaaacatgtatgttggtgagagtgaacgtgctgtgcgacaagtttttcaacga
gccaagaactcagcaccctgtgtgatattctttgatgaagtggatgctttatgtcctcga
agatcagaccgagagacaggggcaagtgtccgagtggtgaatcagctacttacagagatg
gatggtctggaagcacgccagcaggtttttattatggcagccactaacaggccagatata
attgaccctgcaatcctgcgcccgggccgcctggacaaaacactgtttgtgggtttaccg
ccccctgcagatcgccttgccatcttaaaaactatcacaaaaaatggtaccaaaccacca
ctggatgcagatgtaaatttggaagcaattgctggtgaccttcgctgtgattgctatacg
ggcgcagatctctctgctttggtacgagaagcttctatctgtgccctgagacaggaaatg
gcaagacagaagagtggaaatgaaaaaggtgaactcaaggttagtcataagcattttgaa
gaagctttcaagaaagtaagatcatctatatcaaaaaaggatcaaatcatgtatgaacgt
ttgcaggagtccctcagccggtga

DBGET integrated database retrieval system