KEGG   Homo sapiens (human): 4935Help
Entry
4935              CDS       T01001                                 

Gene name
GPR143, NYS6, OA1
Definition
(RefSeq) G protein-coupled receptor 143
  KO
K08470  
Ocular albinism type 1 protein
Organism
hsa  Homo sapiens (human)
Disease
H00169  
Ocular albinism
H00776  
Congenital motor nystagmus (CMN)
Brite
G protein-coupled receptors [BR:hsa04030]
 Others
  Other
   Ocular albinism proteins
    4935 (GPR143)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3
AA seq 404 aa AA seqDB search
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP
ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA
MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS
VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA
VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP
AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG
GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgcgcctagggaccttctgctgccccacgcgggacgcagccacgcagctc
gtgctgagcttccagccgcgggccttccacgcgctctgcctgggcagcggcgggctccgc
ttggcgctgggccttctgcagctgctgcccggccgccggcccgcgggccccgggtccccc
gcgacgtccccgccggcctcggtccgcatcctgcgcgctgccgctgcctgcgaccttctc
ggctgcctgggtatggtgatccggtccaccgtgtggttaggattcccaaattttgttgac
agcgtctcggatatgaaccacacggaaatttggcctgctgctttctgcgtggggagtgcg
atgtggatccagctgttgtacagtgcctgcttctggtggctgttttgctatgcagtggat
gcttatctggtgatccggagatcggcaggactgagcaccatcctgctgtatcacatcatg
gcgtggggcctggccaccctgctctgtgtggagggagccgccatgctctactacccttcc
gtgtccaggtgtgagcggggcctggaccacgccatcccccactatgtcaccatgtacctg
cccctgctgctggttctcgtggcgaaccccatcctgttccaaaagacagtgactgcagtg
gcctctttacttaaaggaagacaaggcatttacacggagaacgagaggaggatgggagcc
gtgatcaagatccgatttttcaaaatcatgctggttttaattatttgttggttgtcgaat
atcatcaatgaaagccttttattctatcttgagatgcaaacagatatcaatggaggttct
ttgaaacctgtcagaactgcagccaagaccacatggtttattatgggaatcctgaatcca
gcccagggatttctcttgtctttggccttctacggctggacaggatgcagcctgggtttt
cagtctcccaggaaggagatccagtgggaatcactgaccacctcggctgctgagggggct
cacccatccccactgatgccccatgaaaaccctgcttccgggaaggtgtctcaagtgggt
gggcagacttctgacgaagccctgagcatgctgtctgaaggttctgatgccagcacaatt
gaaattcacactgcaagtgaatcctgcaacaaaaatgagggtgaccctgctctcccaacc
catggagacctatga

DBGET integrated database retrieval system