KEGG   Homo sapiens (human): 4942Help
Entry
4942              CDS       T01001                                 

Gene name
OAT, GACR, HOGA, OATASE, OKT
Definition
ornithine aminotransferase (EC:2.6.1.13)
Orthology
K00819  
ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Disease
H00189  
Ornithinaemia
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26
AA seq 439 aa AA seqDB search
MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPV
ALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVL
GEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGR
TLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVV
PDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYP
VSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNEL
MKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
KEDELRESIEIINKTILSF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaaactagcacatttgcagaggtttgctgtacttagtcgcggagttcattct
tcagtggcttctgctacatctgttgcaactaaaaaaacagtccaaggccctccaacctct
gatgacatttttgaaagggaatataagtatggtgcacacaactaccatcctttacctgta
gccctggagagaggaaaaggtatttacttatgggatgtagaaggcagaaaatattttgac
ttcctgagttcttacagtgctgtcaaccaagggcattgtcaccccaagattgtgaatgct
ctgaagagtcaagtggacaaattgaccttaacatctagagctttctataataacgtactt
ggtgaatatgaggagtatattactaaacttttcaactaccacaaagttcttcctatgaat
acaggagtggaggctggagagactgcctgtaaactagctcgtaagtggggctataccgtg
aagggcattcagaaatacaaagcaaagattgtttttgcagctgggaacttctggggtagg
acgttgtctgctatctccagttccacagacccaaccagttacgatggttttggaccattt
atgccgggattcgacatcattccctataatgatctgcccgcactggagcgtgctcttcag
gatccaaatgtggctgcgttcatggtagaaccaattcagggtgaagcaggcgttgttgtt
ccggatccaggttacctaatgggagtgcgagagctctgcaccaggcaccaggttctcttt
attgctgatgaaatacagacaggattggccagaactggtagatggctggctgttgattat
gaaaatgtcagacctgatatagtcctccttggaaaggccctttctgggggcttataccct
gtgtctgcagtgctgtgtgatgatgacatcatgctgaccattaagccaggggagcatggg
tccacatacggtggcaatccactaggctgccgagtggccatcgcagcccttgaggtttta
gaagaagaaaaccttgctgaaaatgcagacaaattgggcattatcttgagaaatgaactc
atgaagctaccttctgatgttgtaactgccgtaagaggaaaaggattattaaacgctatt
gtcattaaagaaaccaaagattgggatgcttggaaggtgtgtctacgacttcgagataat
ggacttctggccaagccaacccatggcgacattatcaggtttgcgcctccgctggtgatc
aaggaggatgagcttcgagagtccattgaaattattaacaagaccatcttgtctttctga

DBGET integrated database retrieval system