KEGG   Homo sapiens (human): 494551Help
Entry
494551            CDS       T01001                                 

Gene name
WEE2, WEE1B
Definition
WEE1 homolog 2 (S. pombe) (EC:2.7.10.2)
Orthology
K06632  
wee1-like protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    494551 (WEE2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     494551 (WEE2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  WEE family
   494551 (WEE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7q32
AA seq 567 aa AA seqDB search
MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPL
SNVHELDTSSEKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRL
VISPTGKLPSRGPKHLKLTPAPLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDL
EEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAI
KRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAA
ISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIE
EVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAAL
ARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTG
SRSTKRLVGGKSARSSSFTSGEREPLH
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaagatattgacaaagaactaaggcagaaattaaacttttcctattgtgag
gagactgagattgaagggcagaagaaagtagaagaaagcagggaggcttcgagccaaacc
ccagagaagggtgaagtgcaggattcagaggcaaagggtacaccaccttggactcccctt
agcaacgtgcatgagctcgacacatcttcggaaaaagacaaagaaagtccagatcagatt
ttgaggactccagtgtcacaccctctcaaatgtcctgagacaccagcccaaccagacagc
aggagcaagctgctgcccagtgacagcccctctactcccaaaaccatgctgagccggttg
gtgatttctccaacagggaagcttccttccagaggccctaagcatttgaagctcacacct
gctcccctcaaggatgagatgacctcattggctctggtcaatattaatcccttcactcca
gagtcctataaaaaattatttcttcaatctggtggcaagaggaaaataagaggagatctt
gaggaagctggtccagaggaaggcaagggagggctgcctgccaagagatgtgttttacga
gaaaccaacatggcttcccgctatgaaaaagaattcttggaggttgaaaaaattggggtt
ggcgaatttggtacagtctacaagtgcattaagaggctggatggatgtgtttatgcaata
aagcgctctatgaaaacttttacagaattatcaaatgagaattcggctttgcatgaagtt
tatgctcacgcagtgcttgggcatcacccccatgtggtacgttactattcctcatgggca
gaagatgaccacatgatcattcagaatgaatactgcaatggtgggagtttgcaagctgct
atatctgaaaacactaagtctggcaatcattttgaagagccaaaactcaaggacatcctt
ctacagatttcccttggccttaattacatccacaactctagcatggtacacctggacatc
aaacctagtaatatattcatttgtcacaagatgcaaagtgaatcctctggagtcatagaa
gaagttgaaaatgaagctgattggtttctctctgccaatgtgatgtataaaattggtgac
ctgggccacgcaacatcaataaacaaacccaaagtggaagaaggagatagtcgcttcctg
gctaatgagattttgcaagaggattaccggcaccttcccaaagcagacatatttgccttg
ggattaacaattgcagtggctgcaggagcagagtcattgcccaccaatggtgctgcatgg
caccatatccgcaagggtaactttccggacgttcctcaggagctctcagaaagcttttcc
agtctgctcaagaacatgatccaacctgatgccgaacagagaccttctgcagcagctctg
gccagaaatacagttctccggccttccctgggaaaaacagaagagctccaacagcagctg
aatttggaaaagttcaagactgccacactggaaagggaactgagagaagcccagcaggcc
cagtcaccccagggatatacccatcatggtgacactggggtctctgggacccacacagga
tcaagaagcacaaaacgcctggtgggaggaaagagtgcaaggtcttcaagctttacctca
ggagagcgtgagcctctgcattaa

DBGET integrated database retrieval system